DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Ej and Tspan18

DIOPT Version :9

Sequence 1:NP_523636.1 Gene:Tsp42Ej / 35620 FlyBaseID:FBgn0033132 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_899003.1 Gene:Tspan18 / 241556 MGIID:1917186 Length:248 Species:Mus musculus


Alignment Length:249 Identity:54/249 - (21%)
Similarity:97/249 - (38%) Gaps:71/249 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 GLLVTCI--LIVTCNVFFF---SC--GVTTW-------------GSAVSVYGSYGSALCGGAVFG 57
            |..::|:  |:...|.|.|   :|  ||..|             .:.:...|:|.....||.:|.
Mouse     3 GDCLSCMKYLMFVFNFFVFLGGACLLGVGIWVLVDPTGFREIVATNPLLTTGAYIVLAMGGLLFL 67

  Fly    58 VAFLGMYVALKVSYKYSIYYLICSGLVI-----AALGSYLFTFTAMREQLMGRFEERMRDLFER- 116
            :.|||...|::.:....:::.:...::.     ||:.:::|     ||.|       .|:.|.: 
Mouse    68 LGFLGCCGAVRENRCLLLFFFLFILIIFLVELSAAILAFIF-----REHL-------TREFFTKE 120

  Fly   117 --KTHSDDKMQPVHS--------LFGCCGIEGPQDY--------LQEEHGALPSSCC-------- 155
              |.:..|....|.|        .|||||:.||:|:        |..:...:|.:||        
Mouse   121 LTKHYQGDNDTDVFSATWNSVMITFGCCGVNGPEDFKLASVFRLLTLDTEEVPKACCRREPQTRD 185

  Fly   156 ----YAFDC--SKPAHVYEEGCSTKAVATLRMQAELNYYSCMAIIALE-FLGLF 202
                ...:|  .:...:.::||.|..:.|......|.....:.::|:| ||.:|
Mouse   186 GVVLSREECQLGRNPFINKQGCYTVILNTFETYVYLAGAFAIGVLAIELFLMVF 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EjNP_523636.1 Tetraspannin 11..211 CDD:278750 54/249 (22%)
tetraspanin_LEL 97..183 CDD:239401 26/118 (22%)
Tspan18NP_899003.1 Tetraspannin 10..243 CDD:366035 52/242 (21%)
uroplakin_I_like_LEL 105..218 CDD:239409 27/124 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19282
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.