DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Ej and tsp-11

DIOPT Version :9

Sequence 1:NP_523636.1 Gene:Tsp42Ej / 35620 FlyBaseID:FBgn0033132 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_509546.4 Gene:tsp-11 / 192064 WormBaseID:WBGene00006637 Length:287 Species:Caenorhabditis elegans


Alignment Length:239 Identity:50/239 - (20%)
Similarity:70/239 - (29%) Gaps:91/239 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 KYGLLVTCILIVTCNVFFFSCG-------------------------------VTTWGSAVSVYG 44
            |:.|.:..::.:.|.:.....|                               :.|..:||..:|
 Worm    19 KFSLFIFNLVFLLCGLICLGIGLWLVLDKYAIDNLAFATAKVQGYDQDAGLRDLATKPTAVRQFG 83

  Fly    45 SYGSALCGGAVFGVAFLGMYVALKVSYKYSIYYLICSGLVIA---ALGSYLFTFTAMREQLMGRF 106
             |...:.|..|..|||||...|.|........|..|..|::|   |...|.|..:.|       |
 Worm    84 -YLLFVGGFIVIVVAFLGCCGAAKEWRPLLCCYSSCLMLILAIQIAATIYAFLHSHM-------F 140

  Fly   107 EERMRDLFERKTHSDDKM-----------QPVHSLF------------GCCGIEGP------QDY 142
            |...||:.    ||..||           .|...|.            .|||::..      ..:
 Worm   141 ENDFRDIL----HSSLKMYNGTDNMKVSNNPQDGLLVKTAWDKIMIEKSCCGVDSKIGEFNNSGW 201

  Fly   143 LQEEHG--ALPSSCC----------YAFDCSKPAHVYEEGCSTK 174
            .|..||  ..|.:||          |.....:.:|    ||..|
 Worm   202 YQLNHGRYQFPPACCPPDEHGRLRPYCNTIMRHSH----GCYAK 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EjNP_523636.1 Tetraspannin 11..211 CDD:278750 50/239 (21%)
tetraspanin_LEL 97..183 CDD:239401 25/119 (21%)
tsp-11NP_509546.4 Tetraspannin 18..281 CDD:278750 50/239 (21%)
uroplakin_I_like_LEL 132..247 CDD:239409 27/125 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.