Sequence 1: | NP_523636.1 | Gene: | Tsp42Ej / 35620 | FlyBaseID: | FBgn0033132 | Length: | 227 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_509546.4 | Gene: | tsp-11 / 192064 | WormBaseID: | WBGene00006637 | Length: | 287 | Species: | Caenorhabditis elegans |
Alignment Length: | 239 | Identity: | 50/239 - (20%) |
---|---|---|---|
Similarity: | 70/239 - (29%) | Gaps: | 91/239 - (38%) |
- Green bases have known domain annotations that are detailed below.
Fly 11 KYGLLVTCILIVTCNVFFFSCG-------------------------------VTTWGSAVSVYG 44
Fly 45 SYGSALCGGAVFGVAFLGMYVALKVSYKYSIYYLICSGLVIA---ALGSYLFTFTAMREQLMGRF 106
Fly 107 EERMRDLFERKTHSDDKM-----------QPVHSLF------------GCCGIEGP------QDY 142
Fly 143 LQEEHG--ALPSSCC----------YAFDCSKPAHVYEEGCSTK 174 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Tsp42Ej | NP_523636.1 | Tetraspannin | 11..211 | CDD:278750 | 50/239 (21%) |
tetraspanin_LEL | 97..183 | CDD:239401 | 25/119 (21%) | ||
tsp-11 | NP_509546.4 | Tetraspannin | 18..281 | CDD:278750 | 50/239 (21%) |
uroplakin_I_like_LEL | 132..247 | CDD:239409 | 27/125 (22%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3882 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR19282 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.910 |