DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Ej and TSPAN19

DIOPT Version :9

Sequence 1:NP_523636.1 Gene:Tsp42Ej / 35620 FlyBaseID:FBgn0033132 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_001094387.1 Gene:TSPAN19 / 144448 HGNCID:31886 Length:248 Species:Homo sapiens


Alignment Length:218 Identity:42/218 - (19%)
Similarity:79/218 - (36%) Gaps:71/218 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 LCGGA--VFGVAFLGMYVALKV-------SYKYSIYYLICSGLVIAALGS--------------- 90
            |..||  |.|:.|:|....|.:       ::..:.::::....::..:||               
Human    16 LINGAFLVLGLLFMGFGAWLLLDRNNFLTAFDENNHFIVPISQILIGMGSSTVLFCLLGYIGIHN 80

  Fly    91 ----------YLFTFTAMREQLMGRF----EERMRDLFERKTH-------SDDK---------MQ 125
                      .|.|:|...:.::..|    :|.::.|:..|..       |.||         :.
Human    81 EIRWLLIVYAVLITWTFAVQVVLSAFIITKKEEVQQLWHDKIDFVISEYGSKDKPEDITKWTILN 145

  Fly   126 PVHSLFGCCGIEGPQDYL----QEEHGALPSSCCYA----FDCSKPAH-VYEEGCSTKAVATLRM 181
            .:.....|||.....|::    :|..|.:|.||..:    :.|.:|.: .|.|||..|..|...:
Human   146 ALQKTLQCCGQHNYTDWIKNKNKENSGQVPCSCTKSTLRKWFCDEPLNATYLEGCENKISAWYNV 210

  Fly   182 QAELNYYSCMAIIALEFLGLFTA 204
                   :.:.:|.:.| ||.|:
Human   211 -------NVLTLIGINF-GLLTS 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EjNP_523636.1 Tetraspannin 11..211 CDD:278750 42/218 (19%)
tetraspanin_LEL 97..183 CDD:239401 24/114 (21%)
TSPAN19NP_001094387.1 Tetraspannin 9..240 CDD:278750 42/218 (19%)
CD37_CD82_like_LEL 107..212 CDD:239413 23/111 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
43.870

Return to query results.
Submit another query.