DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Ej and Cd81

DIOPT Version :9

Sequence 1:NP_523636.1 Gene:Tsp42Ej / 35620 FlyBaseID:FBgn0033132 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_598416.1 Gene:Cd81 / 12520 MGIID:1096398 Length:236 Species:Mus musculus


Alignment Length:138 Identity:30/138 - (21%)
Similarity:46/138 - (33%) Gaps:54/138 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 LCGGAVFGVAF---------------LGMYVALKVSYKYSIYYLICSGLVIAALGSYLFTFTAMR 99
            |.||.:.|||.               ||...|....| ..||.||..|.|:..:| :|..:.|::
Mouse    23 LAGGVILGVALWLRHDPQTTSLLYLELGNKPAPNTFY-VGIYILIAVGAVMMFVG-FLGCYGAIQ 85

  Fly   100 EQ--LMGRF----------------------EERMRDL-------FERKTHSDDK------MQPV 127
            |.  |:|.|                      ::..:|:       .::....||.      ::..
Mouse    86 ESQCLLGTFFTCLVILFACEVAAGIWGFVNKDQIAKDVKQFYDQALQQAVMDDDANNAKAVVKTF 150

  Fly   128 HSLFGCCG 135
            |....|||
Mouse   151 HETLNCCG 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EjNP_523636.1 Tetraspannin 11..211 CDD:278750 30/138 (22%)
tetraspanin_LEL 97..183 CDD:239401 12/76 (16%)
Cd81NP_598416.1 Tetraspannin 9..230 CDD:278750 30/138 (22%)
CD81_like_LEL 113..202 CDD:239404 7/46 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.