Sequence 1: | NP_523636.1 | Gene: | Tsp42Ej / 35620 | FlyBaseID: | FBgn0033132 | Length: | 227 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_729926.1 | Gene: | Tsp68C / 117407 | FlyBaseID: | FBgn0043550 | Length: | 362 | Species: | Drosophila melanogaster |
Alignment Length: | 237 | Identity: | 50/237 - (21%) |
---|---|---|---|
Similarity: | 80/237 - (33%) | Gaps: | 89/237 - (37%) |
- Green bases have known domain annotations that are detailed below.
Fly 24 CNVFFFSCGVTTWGSAVSV-----------------------------YGSYGSALCGGAVFGVA 59
Fly 60 FLGMYVALKVSYKY-SIYYLICSGLVIAALGSYLFTFTAMREQLMGRFEERMRDLFERKTHSDDK 123
Fly 124 MQPVHSL----------------------FGCCGIEGPQDY------LQ---EEHGALPSSCCY- 156
Fly 157 -------AFDCSKPAHVYEEGCSTKAVATLRMQAELNYYSCM 191 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Tsp42Ej | NP_523636.1 | Tetraspannin | 11..211 | CDD:278750 | 50/237 (21%) |
tetraspanin_LEL | 97..183 | CDD:239401 | 27/124 (22%) | ||
Tsp68C | NP_729926.1 | Tetraspannin | 8..267 | CDD:278750 | 50/237 (21%) |
tetraspanin_LEL | 117..241 | CDD:239401 | 30/132 (23%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | P | PTHR19282 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.100 |