DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Ej and Tsp68C

DIOPT Version :9

Sequence 1:NP_523636.1 Gene:Tsp42Ej / 35620 FlyBaseID:FBgn0033132 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_729926.1 Gene:Tsp68C / 117407 FlyBaseID:FBgn0043550 Length:362 Species:Drosophila melanogaster


Alignment Length:237 Identity:50/237 - (21%)
Similarity:80/237 - (33%) Gaps:89/237 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 CNVFFFSCGVTTWGSAVSV-----------------------------YGSYGSALCGGAVFGVA 59
            ||..|..||:....|.:.:                             |.:.|.|:.|......|
  Fly    14 CNFLFLICGLLLVVSGLYIFSDNKRILLSRLLAASSDRLSSLPQPLLFYIALGVAIAGFVATLAA 78

  Fly    60 FLGMYVALKVSYKY-SIYYLICSGLVIAALGSYLFTFTAMREQLMGRFEERMRDLFERKTHSDDK 123
            .:|.:.:...:|.: :||:|  |.:|:....|.|.....:....:|              .|.|:
  Fly    79 VVGFWASCLHTYCFLTIYFL--SVVVLLLTESVLCLAITLWPHCLG--------------ISLDE 127

  Fly   124 MQPVHSL----------------------FGCCGIEGPQDY------LQ---EEHGALPSSCCY- 156
            .|.|.||                      |||||:....||      ||   :.:..:|.|||: 
  Fly   128 TQMVRSLQSNYGVPGQEQFTNALDLAQVRFGCCGMRSSLDYDTSLWRLQGYGQRNWPVPLSCCFL 192

  Fly   157 -------AFDCSKPAHVYEEGCSTKAVATLRMQAELNYYSCM 191
                   |:...|||:  |..|  :::..|..:.|.:..||:
  Fly   193 KNAGHSMAYLDPKPAN--ESMC--QSLERLSYERERHTESCL 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EjNP_523636.1 Tetraspannin 11..211 CDD:278750 50/237 (21%)
tetraspanin_LEL 97..183 CDD:239401 27/124 (22%)
Tsp68CNP_729926.1 Tetraspannin 8..267 CDD:278750 50/237 (21%)
tetraspanin_LEL 117..241 CDD:239401 30/132 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.