DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Ej and si:ch73-139j3.4

DIOPT Version :9

Sequence 1:NP_523636.1 Gene:Tsp42Ej / 35620 FlyBaseID:FBgn0033132 Length:227 Species:Drosophila melanogaster
Sequence 2:XP_005164654.1 Gene:si:ch73-139j3.4 / 101884436 ZFINID:ZDB-GENE-140106-202 Length:355 Species:Danio rerio


Alignment Length:273 Identity:64/273 - (23%)
Similarity:102/273 - (37%) Gaps:73/273 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 KYGLLVTCILIVTCNVFFFSCGVTTW-----GSAVSVY--GSYGSALCGGAVF------GVAFLG 62
            |:..::.....|...:..|:|  :.|     .|.|||.  |.....:.||..|      ||:.||
Zfish    11 KFFFMLVNAFFVILGISIFAC--SAWILFDKDSFVSVLSSGQEVKVVAGGLFFIGLVVVGVSLLG 73

  Fly    63 MYVALKVSYKYSIYYLICSGLVIAALGSYLFTFTAM-REQLMGRFEERMRDLFER--KTHSDDKM 124
            ...|...|..:.|:||  |.|::..||....||..: |.:.:.:|   :||..:.  |.:..|::
Zfish    74 CAGAYFESRCFIIFYL--SFLIVIILGQIFITFVLLIRRKTIEQF---LRDKVDEIIKQYGGDEI 133

  Fly   125 Q-------PVHSLFGCCG---------------IEGPQDYLQEEHGALPSSC----C-------Y 156
            |       .|.:...|||               :.|...|        |.||    |       |
Zfish   134 QTSWKLLDSVQTSARCCGRLNSNEWRNNTVIASLGGTDIY--------PCSCFNGTCPVILEETY 190

  Fly   157 AFDCSKPAHVYEEGCSTKAVATLRMQAELNYYSCMAIIALEFLGLFTAYH----LG-KARKYAKT 216
            :|  ...:.|:|.||....|..|.|...:.:...:|:|.::.:....|..    :| |.|:...:
Zfish   191 SF--GNGSDVFERGCEETLVNWLEMNIIVIFGMDVALILIQIMQFIFAVQTFKCIGRKTRELHPS 253

  Fly   217 KIKD--EETPIND 227
            .:.:  ||.|..|
Zfish   254 NLLNAMEENPAAD 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EjNP_523636.1 Tetraspannin 11..211 CDD:278750 59/253 (23%)
tetraspanin_LEL 97..183 CDD:239401 26/121 (21%)
si:ch73-139j3.4XP_005164654.1 Tetraspannin 10..237 CDD:306775 56/242 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
43.870

Return to query results.
Submit another query.