DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Ei and Tsp86D

DIOPT Version :9

Sequence 1:NP_001260756.1 Gene:Tsp42Ei / 35618 FlyBaseID:FBgn0033130 Length:229 Species:Drosophila melanogaster
Sequence 2:NP_001262468.1 Gene:Tsp86D / 41310 FlyBaseID:FBgn0037848 Length:316 Species:Drosophila melanogaster


Alignment Length:269 Identity:52/269 - (19%)
Similarity:112/269 - (41%) Gaps:51/269 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 ATTVKHVLLLLNFVFSVLGLALIAFGIFFLIS---------AAENAVSIGKNVAGGLIIALGVVI 60
            ::.||:::.||||:|.:.|..|:|.|::..:.         ..:....:..|::..:||| ||::
  Fly    28 SSCVKYMIFLLNFLFWLFGGLLLAIGVYAFMDKLMDGNGWLRLDTIYDVIFNISLVMIIA-GVIV 91

  Fly    61 LIIAIFGCLAAIHEAPVRLLIYVGAVVLLILAQLIFLGMSSHGTKDGISGSINEGF-DRLWESER 124
            ..::..|||.|:.|....|.:|...::|..:.:: .|.:........::..:...| |::..|.|
  Fly    92 FTVSFAGCLGALRENTWLLKLYSMCLLLFFILEM-SLAIICFVFPQYMNSFLEYQFTDKIIHSYR 155

  Fly   125 NQT---GALSYYESWLQCCGVN-------SSEDYW------IIHHGIPSSCCPESKCMDT----- 168
            :.:   ..:.:.:....|||::       |..:|:      :...|:|.|||..:..:.:     
  Fly   156 DDSDLQNFIDFAQQEFNCCGLSNAGYQDWSKNEYFNCSSPSVERCGVPYSCCINATDISSGLVNI 220

  Fly   169 --------------PSRVFKTGCKAAFVKYLDDKLLVFKIVCWLLVIGEAVGAVFGWLLYSSVKN 219
                          ..|::.:||......:::..|.|...|    .:|.|:..:|...|..:::.
  Fly   221 MCGYGVQVRSVAAASKRIWTSGCIEIVRVWVERNLYVIAGV----ALGIALLQLFVIYLAKTLEG 281

  Fly   220 QSRRNNAVW 228
            |.....:.|
  Fly   282 QIDLQKSRW 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EiNP_001260756.1 Tetraspannin 7..217 CDD:278750 50/254 (20%)
DUF373 <17..>101 CDD:299895 21/92 (23%)
tetraspanin_LEL 104..189 CDD:239401 17/120 (14%)
Tsp86DNP_001262468.1 Tetraspannin 51..283 CDD:278750 41/237 (17%)
penumbra_like_LEL 132..255 CDD:239411 17/122 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442918
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.