DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Eh and CD37

DIOPT Version :9

Sequence 1:NP_523634.1 Gene:Tsp42Eh / 35617 FlyBaseID:FBgn0033129 Length:231 Species:Drosophila melanogaster
Sequence 2:XP_005259492.1 Gene:CD37 / 951 HGNCID:1666 Length:365 Species:Homo sapiens


Alignment Length:187 Identity:49/187 - (26%)
Similarity:74/187 - (39%) Gaps:32/187 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LLRYVLCVISGICALGGCLLIWYGAWLLDSLSEEQRMLGMDHGEDLAAVLCVLLGTVIVVASIF- 70
            |::|.|.|.:....:.|.|:..:|.|:|...:.....:|      ||.|...:...|:.::.|| 
Human    10 LIKYFLFVFNLFFFVLGSLIFCFGIWILIDKTSFVSFVG------LAFVPLQIWSKVLAISGIFT 68

  Fly    71 ------GSVAVAKDSRVLLICYAVLLVFLLIVQIVLVSISYAASRDFLPDSLRQGLDDLWDLQHE 129
                  |.|...|:.|.||..|..:|:.|...||.| .|..:..|..|..|||..::.  .:|..
Human    69 MGIALLGCVGALKELRCLLGLYFGMLLLLFATQITL-GILISTQRAQLERSLRDVVEK--TIQKY 130

  Fly   130 GNSTLNT--YEEW------LHCCGRNSAEDYLHL--------EKMPPPSCCLNRDCT 170
            |.:...|  .|.|      |.|||.:..:|:..:        |....|..|.|...|
Human   131 GTNPEETAAEESWDYVQFQLRCCGWHYPQDWFQVLILRGNGSEAHRVPCSCYNLSAT 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EhNP_523634.1 Tetraspannin 8..220 CDD:278750 48/186 (26%)
tetraspanin_LEL 109..192 CDD:239401 20/78 (26%)
CD37XP_005259492.1 Tetraspannin 26..269 CDD:278750 45/171 (26%)
CD37_CD82_like_LEL 108..243 CDD:239413 20/82 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.