DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Eh and TSPAN18

DIOPT Version :9

Sequence 1:NP_523634.1 Gene:Tsp42Eh / 35617 FlyBaseID:FBgn0033129 Length:231 Species:Drosophila melanogaster
Sequence 2:XP_005253274.1 Gene:TSPAN18 / 90139 HGNCID:20660 Length:258 Species:Homo sapiens


Alignment Length:241 Identity:56/241 - (23%)
Similarity:98/241 - (40%) Gaps:53/241 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LRYVLCVISGICALGGCLLIWYGAWLLDSLSEEQRMLGMDHGEDLAAVLCVLLGTVIVVASIFGS 72
            ::|::.|.:....|||..|:..|.|::...:..:.::..:......|.:.:.:|.::.:....|.
Human    19 MKYLMFVFNFFIFLGGACLLAIGIWVMVDPTGFREIVAANPLLLTGAYILLAMGGLLFLLGFLGC 83

  Fly    73 VAVAKDSRVLLICYAVLLVFLLIVQIVLVSISYA---------ASRDFLPDSLR---QGLDDLWD 125
            ....::::.||     |..||.|:.|.|..:|.|         .:|:|....|.   ||.:|...
Human    84 CGAVRENKCLL-----LFFFLFILIIFLAELSAAILAFIFRENLTREFFTKELTKHYQGNNDTDV 143

  Fly   126 LQHEGNSTLNTYEEWLHCCGRNSAEDY----------LHLEKMPPPSCC-----------LNR-D 168
            .....||.:.|:    .|||.|..||:          |..|:: |.:||           |:| :
Human   144 FSATWNSVMITF----GCCGVNGPEDFKFASVFRLLTLDSEEV-PEACCRREPQSRDGVLLSREE 203

  Fly   169 CTKHLNLFMT--GCEV----KFKEYV---GAKTANFHSLSWFLVIF 205
            |....:||:.  ||..    .|:.||   ||......::..|.:||
Human   204 CLLGRSLFLNKQGCYTVILNTFETYVYLAGALAIGVLAIELFAMIF 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EhNP_523634.1 Tetraspannin 8..220 CDD:278750 56/241 (23%)
tetraspanin_LEL 109..192 CDD:239401 32/116 (28%)
TSPAN18XP_005253274.1 Tetraspannin 20..253 CDD:395265 56/240 (23%)
uroplakin_I_like_LEL 115..228 CDD:239409 28/117 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.