DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Eh and tspan37

DIOPT Version :9

Sequence 1:NP_523634.1 Gene:Tsp42Eh / 35617 FlyBaseID:FBgn0033129 Length:231 Species:Drosophila melanogaster
Sequence 2:NP_001292501.1 Gene:tspan37 / 564334 ZFINID:ZDB-GENE-070912-550 Length:245 Species:Danio rerio


Alignment Length:227 Identity:54/227 - (23%)
Similarity:84/227 - (37%) Gaps:50/227 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 VLCVISGICALGGCLLIWYGAWLLDSLSEEQRMLGMDHGE---DLAAVLCVLLGTVIVVASIFGS 72
            :|.:::||..|||..|:           .:.|:.|:....   ...|:|.|:.|.::.:....|.
Zfish    17 LLFLLTGITGLGGSFLL-----------HKYRVYGLFFSNLYIIFPALLAVVSGAILFITGSIGC 70

  Fly    73 VAVAKDSRVLLICYAVLLVFLLIVQIVLVSISYAASRDFLPDSLRQGLDDLWDL--QHEGNS--- 132
            :..:|...    |...|.|:.||:...:|..: ||...|....|...|..|.|:  .:..||   
Zfish    71 LVSSKKPS----CGHGLFVYFLIIVFCVVGTT-AALAYFYQGKLDAELAPLKDVFQNYSNNSQDP 130

  Fly   133 ---TLNTYEEWLHCCGRNSAEDYL------HLEKMPPPSCCLN---RDCTKHLN----LFMTGCE 181
               .::..:..|.|||..:..|:|      |..|...|..|.|   ..|...|:    |:...|:
Zfish   131 DTKAVDRLQSELQCCGVMNYTDWLQTPWFNHSGKYDVPQSCCNTTFHSCNGTLDAPMLLYNEACQ 195

  Fly   182 VKFKEYVGAKTANFH----------SLSWFLV 203
            ||.||.:.......|          .|||..|
Zfish   196 VKLKELLLLVVHIIHITSLVVLVLLVLSWITV 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EhNP_523634.1 Tetraspannin 8..220 CDD:278750 54/227 (24%)
tetraspanin_LEL 109..192 CDD:239401 26/103 (25%)
tspan37NP_001292501.1 Tetraspannin 14..194 CDD:278750 44/192 (23%)
TM4SF8_like_LEL 102..195 CDD:239416 21/92 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D570819at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.