Sequence 1: | NP_523634.1 | Gene: | Tsp42Eh / 35617 | FlyBaseID: | FBgn0033129 | Length: | 231 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001292501.1 | Gene: | tspan37 / 564334 | ZFINID: | ZDB-GENE-070912-550 | Length: | 245 | Species: | Danio rerio |
Alignment Length: | 227 | Identity: | 54/227 - (23%) |
---|---|---|---|
Similarity: | 84/227 - (37%) | Gaps: | 50/227 - (22%) |
- Green bases have known domain annotations that are detailed below.
Fly 11 VLCVISGICALGGCLLIWYGAWLLDSLSEEQRMLGMDHGE---DLAAVLCVLLGTVIVVASIFGS 72
Fly 73 VAVAKDSRVLLICYAVLLVFLLIVQIVLVSISYAASRDFLPDSLRQGLDDLWDL--QHEGNS--- 132
Fly 133 ---TLNTYEEWLHCCGRNSAEDYL------HLEKMPPPSCCLN---RDCTKHLN----LFMTGCE 181
Fly 182 VKFKEYVGAKTANFH----------SLSWFLV 203 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Tsp42Eh | NP_523634.1 | Tetraspannin | 8..220 | CDD:278750 | 54/227 (24%) |
tetraspanin_LEL | 109..192 | CDD:239401 | 26/103 (25%) | ||
tspan37 | NP_001292501.1 | Tetraspannin | 14..194 | CDD:278750 | 44/192 (23%) |
TM4SF8_like_LEL | 102..195 | CDD:239416 | 21/92 (23%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3882 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D570819at33208 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.910 |