DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Eh and tspan35

DIOPT Version :9

Sequence 1:NP_523634.1 Gene:Tsp42Eh / 35617 FlyBaseID:FBgn0033129 Length:231 Species:Drosophila melanogaster
Sequence 2:NP_956702.2 Gene:tspan35 / 393380 ZFINID:ZDB-GENE-040426-1362 Length:243 Species:Danio rerio


Alignment Length:194 Identity:50/194 - (25%)
Similarity:90/194 - (46%) Gaps:22/194 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LRYVLCVISGICALGGCLLIWYGAWL-LDS---LSEEQRMLGMDH--GEDL-AAVLCVLLGTVIV 65
            |:.::.:.:||..|.|.:::..|.|: :|:   |:..|.:.|...  |:.| ...|.:.||.|:|
Zfish     7 LKTMMFLFNGIIFLAGGVILGVGIWVKVDNGSILNFMQSLPGASSQMGQVLNVGYLLIALGAVLV 71

  Fly    66 VASIFGSVAVAKDSRVLLICYAVLLVFLLIVQIVLVSISYAASRDFLPDSLRQ-GLDDLWDLQHE 129
            |....|.....|:||.:|:.:.::::.:.|.: |..:|...|.|......::| |:|.:..||.:
Zfish    72 VLGFLGCCGAIKESRCMLMLFFIIILIIFIAE-VAGAIVILAFRPLAETLIKQLGVDAVKSLQSD 135

  Fly   130 GNST------LNTYEEWLHCCGRNSAED-----YLHLEKMPPPSCCLNRDCTKH--LNLFMTGC 180
            ....      .||....:.|||.|:..|     :::..|..|..||....|.:.  :|..:|||
Zfish   136 FGKNPDVTGLWNTTMTGMKCCGFNNYTDFTNSFFVNSTKNYPVQCCNTSPCNQAAVMNSTVTGC 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EhNP_523634.1 Tetraspannin 8..220 CDD:278750 50/194 (26%)
tetraspanin_LEL 109..192 CDD:239401 22/86 (26%)
tspan35NP_956702.2 Tetraspannin 7..239 CDD:278750 50/194 (26%)
uroplakin_I_like_LEL 116..211 CDD:239409 21/84 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.