DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Eh and zgc:64051

DIOPT Version :9

Sequence 1:NP_523634.1 Gene:Tsp42Eh / 35617 FlyBaseID:FBgn0033129 Length:231 Species:Drosophila melanogaster
Sequence 2:NP_956665.1 Gene:zgc:64051 / 393342 ZFINID:ZDB-GENE-040426-1349 Length:221 Species:Danio rerio


Alignment Length:204 Identity:53/204 - (25%)
Similarity:91/204 - (44%) Gaps:34/204 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MYCTTRLLRYVLCVISGICALGGCLLIWYGAWL-----LDSLSEEQRMLGMDHGEDLAAVLCVLL 60
            |.| .:.|:|::||::.|..:.|..:...|.:|     |..|...|.|       .:|..| .:.
Zfish     1 MSC-LKCLKYIMCVVNFIFFICGAAIFGMGIYLMTFSRLSLLPSLQAM-------SIANTL-FIT 56

  Fly    61 GTVIVVASIFGSVAVAKDSRVLLICYAVLLVFLLIVQIV---LVSISYAASRDFLPDSLRQGLDD 122
            |.:|...|..|.:...|::|.|||.:.:||..|::.::.   |:.:..:...:|:.|.|..||:.
Zfish    57 GIIITCVSFLGFLGALKENRCLLISFFILLFILMLAELAAACLMLMYESKIENFIKDDLVDGLNQ 121

  Fly   123 LWDLQHEGNST--LNTYEEWLHCCGRNSAEDYLHLEKMPPPSCCL------NRDCTKHL------ 173
            ....:.:.|:|  .:..:|...|||..:|.|:   :...|.||.:      ::.|.|.|      
Zfish   122 SIKNRKQHNTTDDWDKVQETFGCCGIQNATDW---QGFVPQSCNISGTSNWHKGCFKLLENSFES 183

  Fly   174 NLFMTGCEV 182
            ||..||..|
Zfish   184 NLLSTGIGV 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EhNP_523634.1 Tetraspannin 8..220 CDD:278750 51/197 (26%)
tetraspanin_LEL 109..192 CDD:239401 24/88 (27%)
zgc:64051NP_956665.1 Tetraspannin 6..213 CDD:278750 51/198 (26%)
CD53_like_LEL 101..189 CDD:239417 21/90 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.