Sequence 1: | NP_523634.1 | Gene: | Tsp42Eh / 35617 | FlyBaseID: | FBgn0033129 | Length: | 231 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_956665.1 | Gene: | zgc:64051 / 393342 | ZFINID: | ZDB-GENE-040426-1349 | Length: | 221 | Species: | Danio rerio |
Alignment Length: | 204 | Identity: | 53/204 - (25%) |
---|---|---|---|
Similarity: | 91/204 - (44%) | Gaps: | 34/204 - (16%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MYCTTRLLRYVLCVISGICALGGCLLIWYGAWL-----LDSLSEEQRMLGMDHGEDLAAVLCVLL 60
Fly 61 GTVIVVASIFGSVAVAKDSRVLLICYAVLLVFLLIVQIV---LVSISYAASRDFLPDSLRQGLDD 122
Fly 123 LWDLQHEGNST--LNTYEEWLHCCGRNSAEDYLHLEKMPPPSCCL------NRDCTKHL------ 173
Fly 174 NLFMTGCEV 182 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Tsp42Eh | NP_523634.1 | Tetraspannin | 8..220 | CDD:278750 | 51/197 (26%) |
tetraspanin_LEL | 109..192 | CDD:239401 | 24/88 (27%) | ||
zgc:64051 | NP_956665.1 | Tetraspannin | 6..213 | CDD:278750 | 51/198 (26%) |
CD53_like_LEL | 101..189 | CDD:239417 | 21/90 (23%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3882 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |