DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Eh and TM4SF

DIOPT Version :9

Sequence 1:NP_523634.1 Gene:Tsp42Eh / 35617 FlyBaseID:FBgn0033129 Length:231 Species:Drosophila melanogaster
Sequence 2:NP_001261159.1 Gene:TM4SF / 37786 FlyBaseID:FBgn0020372 Length:292 Species:Drosophila melanogaster


Alignment Length:233 Identity:59/233 - (25%)
Similarity:83/233 - (35%) Gaps:52/233 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 RLLRYVLCVISGICALGGCLLIWYGAWLLDSLSEEQRMLGMDHGEDLAAVLCVLLGTVIVVASIF 70
            :..:|::.....:.||.|...|:.|..||...|....::........|.:||  ||.|..:....
  Fly     8 KCFKYLVYSYVVLLALTGAAQIFLGTSLLWGHSVYYGIVQNKLWAPAAILLC--LGPVTFILCWM 70

  Fly    71 GSVAVAKDSRVLLICYAVLLVFLLIVQIVLVSISYAASRDFLPDSLRQGLDD------------- 122
            |..|..:..|.||..:|.|||..:.||.::...| .|.|:.||.|:...:||             
  Fly    71 GCQATNQRKRCLLGMFAALLVACICVQFIICGWS-LAMRENLPTSVEIFIDDSFVEFLDKFSRTK 134

  Fly   123 -----LWDLQHEGNSTLNTYEEWLHCCGRNSAEDYLHLEKMPPPSCCLNRD------CTKHLNLF 176
                 ||          |..:..|.|||.:...||..|..  |.|||...:      |..|   :
  Fly   135 VDNLHLW----------NRMQSQLQCCGVDGPLDYRRLSL--PWSCCSRPEHAYESACDTH---Y 184

  Fly   177 MTGCEVKFKEYV----------GAKTANFHSLSWFLVI 204
            ..||.....|.:          .|..|.|.||..|..:
  Fly   185 KRGCLAVVSEQIRNRLLITAFGAAIIAIFQSLGIFCAV 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EhNP_523634.1 Tetraspannin 8..220 CDD:278750 59/231 (26%)
tetraspanin_LEL 109..192 CDD:239401 26/116 (22%)
TM4SFNP_001261159.1 Tetraspannin 9..224 CDD:278750 59/232 (25%)
uroplakin_I_like_LEL 111..197 CDD:239409 24/100 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.