Sequence 1: | NP_523634.1 | Gene: | Tsp42Eh / 35617 | FlyBaseID: | FBgn0033129 | Length: | 231 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_002222.1 | Gene: | CD82 / 3732 | HGNCID: | 6210 | Length: | 267 | Species: | Homo sapiens |
Alignment Length: | 198 | Identity: | 42/198 - (21%) |
---|---|---|---|
Similarity: | 76/198 - (38%) | Gaps: | 39/198 - (19%) |
- Green bases have known domain annotations that are detailed below.
Fly 6 RLLRYVLCVISGICALGGCLLIWYGAWLLDSLSEEQRMLGMDHGE-DLAAVLCVLLGTVIVVASI 69
Fly 70 FGSVAVAKDSRVLLICYAVLLVFLLIVQIVLVSISY---------------AASRDFLPDSLRQG 119
Fly 120 LDDLWDLQHEGNSTLNTYEEWLHCCGRNSAEDYL-HLEKMPPPSCCLNRDCTKHLNLFMTGCEVK 183
Fly 184 FKE 186 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Tsp42Eh | NP_523634.1 | Tetraspannin | 8..220 | CDD:278750 | 42/196 (21%) |
tetraspanin_LEL | 109..192 | CDD:239401 | 20/79 (25%) | ||
CD82 | NP_002222.1 | Tetraspannin | 24..256 | CDD:278750 | 39/181 (22%) |
CD37_CD82_like_LEL | 106..229 | CDD:239413 | 21/99 (21%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3882 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |