DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Eh and Tsp42Er

DIOPT Version :9

Sequence 1:NP_523634.1 Gene:Tsp42Eh / 35617 FlyBaseID:FBgn0033129 Length:231 Species:Drosophila melanogaster
Sequence 2:NP_523644.1 Gene:Tsp42Er / 35629 FlyBaseID:FBgn0033139 Length:211 Species:Drosophila melanogaster


Alignment Length:222 Identity:50/222 - (22%)
Similarity:100/222 - (45%) Gaps:22/222 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LLRYVLCVISGICALGGCLLIWYGAWLLDSLS-EEQRMLGMDHGEDLAAVLCVLLGTVIVVASIF 70
            ::||:..:.:.:||:.|...|......:|.:: ::|.:||          |.:.:|:::.:.|.|
  Fly     7 MIRYLAFLFNFLCAVLGIATIVVNVIAIDQIAPKDQLILG----------LYIAVGSIVFLLSFF 61

  Fly    71 GSVAVAKDSRVLLICYAVLLVFLLIVQIVLVSISYAASRDFLPDSLRQGLDDLWDLQHEGNSTLN 135
            |.....|:|..:...||..::.:|||.||::   :.....|..||:.: |...:..|......:.
  Fly    62 GCFGAIKESICVTWAYATSMLVMLIVSIVML---FVFRMHFEEDSITK-LKQAFAKQTNTFDAMA 122

  Fly   136 TYEEWLHCCGRNSAEDYLHLEKMPPPSCCLNRDCTKHLNLFMTGCEVKFKEYV-GAKTANFHSLS 199
            .|:....|||....:||.. ..:..||.|.:::.|.:.:..:...|.:::|.: |.|.     :.
  Fly   123 EYQTQYQCCGIYKLKDYGD-AYITVPSSCYDQNDTPYRDGCLAKMETQYEELLKGPKI-----VG 181

  Fly   200 WFLVIFEFAGSVTTCYLVDSIRNHRDR 226
            |.|::.|......:..:..|:||...|
  Fly   182 WMLMVIEIGAFTFSTIMGVSLRNELRR 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EhNP_523634.1 Tetraspannin 8..220 CDD:278750 46/213 (22%)
tetraspanin_LEL 109..192 CDD:239401 18/83 (22%)
Tsp42ErNP_523644.1 Tetraspannin 8..195 CDD:278750 46/206 (22%)
tetraspanin_LEL 93..174 CDD:239401 17/82 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467712
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D570819at33208
OrthoFinder 1 1.000 - - FOG0001737
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.