DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Eh and Tsp42Eo

DIOPT Version :9

Sequence 1:NP_523634.1 Gene:Tsp42Eh / 35617 FlyBaseID:FBgn0033129 Length:231 Species:Drosophila melanogaster
Sequence 2:NP_523641.2 Gene:Tsp42Eo / 35625 FlyBaseID:FBgn0033136 Length:219 Species:Drosophila melanogaster


Alignment Length:235 Identity:59/235 - (25%)
Similarity:93/235 - (39%) Gaps:35/235 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 TTRL-LRYVLCVISGICALGGCLLIWYGAWLLDSLSEEQRMLGMDHGE-----DLAAVLCVLLGT 62
            |.|: |::...|.|.:..:.|.|....|.:.||..:|.    ..:|.|     .:|..| :|.|.
  Fly     3 TVRVCLQWTSVVFSTLTLIVGVLAALAGVYELDKFNEG----SAEHTEKFVQLGMAGAL-ILAGL 62

  Fly    63 VIVVASIFGSVAVAKDSRVLLICYAVLLVFLLIVQIVLVSISYAASRDFLPDSLRQGLDDLW--D 125
            |..:.:||||:.|       ::...:||:.|:...|..|| .|..::..  |:....:.|||  :
  Fly    63 VGCLGAIFGSIKV-------MVVNLILLLALIASHIWKVS-HYNETKQL--DATEVYVMDLWMKE 117

  Fly   126 LQHEGNSTLNTYEEWLHCCGRNSAEDYLHLEKMPPPSCCLNRDCTKHLNLFMTGCEVKFKEYVGA 190
            |.|.|  .:...::...|||.....||..|....|.||...:|....|..:..||....|.   |
  Fly   118 LVHHG--AMQDLQQEYECCGDKGFSDYTSLNMKVPRSCFHTKDGIHALYPYGEGCMAAVKR---A 177

  Fly   191 KTANFHSLSWF---LVIFEFAGSV----TTCYLVDSIRNH 223
            ....:....|.   |:.:|..|.:    ..|.|.:..|.:
  Fly   178 YLQIYRYEKWVHCGLIGYEVVGIILGITLCCQLTNKTRRY 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EhNP_523634.1 Tetraspannin 8..220 CDD:278750 56/225 (25%)
tetraspanin_LEL 109..192 CDD:239401 22/84 (26%)
Tsp42EoNP_523641.2 Tetraspannin 7..210 CDD:278750 55/222 (25%)
tetraspanin_LEL 110..178 CDD:239401 20/72 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001737
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.