DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Eh and lbm

DIOPT Version :9

Sequence 1:NP_523634.1 Gene:Tsp42Eh / 35617 FlyBaseID:FBgn0033129 Length:231 Species:Drosophila melanogaster
Sequence 2:NP_001260757.1 Gene:lbm / 35623 FlyBaseID:FBgn0016032 Length:208 Species:Drosophila melanogaster


Alignment Length:248 Identity:69/248 - (27%)
Similarity:109/248 - (43%) Gaps:59/248 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MYCTT---RLLRYVLCVISGICALGGCLLIWYGAWLLDSLSEEQRMLGMDHGEDLAAVLCVLLGT 62
            |.|.|   ::...||..:.|..|.|....|.|.|   |:.:||..:        .|.:.|    :
  Fly     1 MGCATTSVKIASIVLNAVLGFLAAGAIGWIAYNA---DTETEEFVI--------AAYIAC----S 50

  Fly    63 VIVVASIFGSVAVAKDSRVLLICYAVLLVFLLIVQIV----------------LVSISYAASRDF 111
            :|:|.::.|..|..::|.||....||.|:.|.|:|||                :|.:::.|:.  
  Fly    51 LILVFALLGIFAAIRESVVLTATSAVFLLILAILQIVSTCLFLHEFDVKSGRDMVEVAWQANN-- 113

  Fly   112 LPDSLRQGLDDLWDLQHEGNSTLNTYEEWLHCCGRNSAEDYLHLEKMPPPSCCLNRDCTKHLNLF 176
             .|||:|        :||             |||::||:||:||..:.||||..:...|.. :|:
  Fly   114 -MDSLQQ--------KHE-------------CCGQSSAQDYIHLSLLIPPSCYADLQQTPD-HLY 155

  Fly   177 MTGCEVKFKEYVGAKTANFHSLSWFLVIFEFAGSVTTCYLVDSIRNHRDRIRF 229
            :.||..|.:.:..:....|..:||.||.||........:|..|.:|.:.|:.|
  Fly   156 LDGCIEKVQSFYESDKLRFIIVSWVLVAFELICFALAVFLAISFKNKQRRMEF 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EhNP_523634.1 Tetraspannin 8..220 CDD:278750 62/227 (27%)
tetraspanin_LEL 109..192 CDD:239401 24/82 (29%)
lbmNP_001260757.1 Tetraspannin 8..198 CDD:278750 62/229 (27%)
tetraspanin_LEL <109..169 CDD:239401 25/84 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467730
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001737
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.