DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Eh and Tsp42Ek

DIOPT Version :9

Sequence 1:NP_523634.1 Gene:Tsp42Eh / 35617 FlyBaseID:FBgn0033129 Length:231 Species:Drosophila melanogaster
Sequence 2:NP_001246161.1 Gene:Tsp42Ek / 35621 FlyBaseID:FBgn0033133 Length:215 Species:Drosophila melanogaster


Alignment Length:234 Identity:49/234 - (20%)
Similarity:95/234 - (40%) Gaps:24/234 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MYCTTRLLRYVLCVISGICALGGCLLIWYGAWLLDSLSEEQRMLGMDHGEDLAAVLCVL-LGTVI 64
            |.||:..::..|..::.:.||.|..||......|..             ..:|.:|.:. ||.:|
  Fly     1 MGCTSGCVKCFLNTLNTLNALSGLSLIAIATLALSK-------------APIAYILFLYGLGGII 52

  Fly    65 VVASIFGSVAVAKDSRVLLICYAVLLVFLLIVQIVLVSIS---YAASRDFLPDSLRQGLDDLWDL 126
            .|:::.|...:..::    :|......|||:.|:::..:.   :..:.:::.....:.:...||.
  Fly    53 FVSAVLGCCGICMEN----VCMTATYGFLLLAQLIISLLGIFRFKFTEEYIEKFAAEEVQMKWDE 113

  Fly   127 QHEGNSTLNTYEEWLHCCGRNSAEDYLHLEKMP-PPSCCLNRDCTKHLNLFMTGCEVKFKEYVGA 190
            :......::.|:....||||:|.:||:.:.:.. ||||....|  ..:..::.||..|..|....
  Fly   114 ELVEPGAMDIYQTVYECCGRDSPDDYVAIGRQTLPPSCYPQED--PQMPHYLAGCVQKSSENFVV 176

  Fly   191 KTANFHSLSWFLVIFEFAGSVTTCYLVDSIRNHRDRIRF 229
            ..:..|..:|..:.......:...|||...|..|.|..:
  Fly   177 LFSYAHDTNWIALGITILMMIAAFYLVGRFRKQRVRYTY 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EhNP_523634.1 Tetraspannin 8..220 CDD:278750 43/216 (20%)
tetraspanin_LEL 109..192 CDD:239401 19/83 (23%)
Tsp42EkNP_001246161.1 Tetraspannin 7..202 CDD:278750 40/213 (19%)
tetraspanin_LEL 94..174 CDD:239401 19/81 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D570819at33208
OrthoFinder 1 1.000 - - FOG0001737
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.