DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Eh and Tsp42Ej

DIOPT Version :9

Sequence 1:NP_523634.1 Gene:Tsp42Eh / 35617 FlyBaseID:FBgn0033129 Length:231 Species:Drosophila melanogaster
Sequence 2:NP_523636.1 Gene:Tsp42Ej / 35620 FlyBaseID:FBgn0033132 Length:227 Species:Drosophila melanogaster


Alignment Length:205 Identity:44/205 - (21%)
Similarity:83/205 - (40%) Gaps:32/205 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 VLCVLLGTVIV------------VASIFGS------------VAVAKDSRVLLICYAVLLVFLLI 95
            |.|:|:.|..|            ..|::||            ||.......|.:.|...:.:|:.
  Fly    16 VTCILIVTCNVFFFSCGVTTWGSAVSVYGSYGSALCGGAVFGVAFLGMYVALKVSYKYSIYYLIC 80

  Fly    96 VQIVLVSI-----SYAASRDFLPDSLRQGLDDLWDLQHEGNSTLNTYEEWLHCCGRNSAEDYLHL 155
            ..:|:.::     ::.|.|:.|.....:.:.||::.:...:..:........|||....:|||..
  Fly    81 SGLVIAALGSYLFTFTAMREQLMGRFEERMRDLFERKTHSDDKMQPVHSLFGCCGIEGPQDYLQE 145

  Fly   156 EK-MPPPSCCLNRDCTKHLNLFMTGCEVKFKEYVGAKT-ANFHSLSWFLVIFEFAGSVTTCYLVD 218
            |. ..|.|||...||:|..:::..||..|....:..:. .|::| ...::..||.|..|..:|..
  Fly   146 EHGALPSSCCYAFDCSKPAHVYEEGCSTKAVATLRMQAELNYYS-CMAIIALEFLGLFTAYHLGK 209

  Fly   219 SIRNHRDRIR 228
            :.:..:.:|:
  Fly   210 ARKYAKTKIK 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EhNP_523634.1 Tetraspannin 8..220 CDD:278750 43/195 (22%)
tetraspanin_LEL 109..192 CDD:239401 21/83 (25%)
Tsp42EjNP_523636.1 Tetraspannin 11..211 CDD:278750 43/195 (22%)
tetraspanin_LEL 97..183 CDD:239401 22/85 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.