DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Eh and Tsp42Ec

DIOPT Version :9

Sequence 1:NP_523634.1 Gene:Tsp42Eh / 35617 FlyBaseID:FBgn0033129 Length:231 Species:Drosophila melanogaster
Sequence 2:NP_523629.1 Gene:Tsp42Ec / 35612 FlyBaseID:FBgn0033124 Length:232 Species:Drosophila melanogaster


Alignment Length:229 Identity:64/229 - (27%)
Similarity:110/229 - (48%) Gaps:24/229 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MYCTTRLLRYVLCVISGICALGGCLLIWYGAWLLDSLSEEQRMLGMDHGEDLAAV-LCV-LLGTV 63
            |.|.:.::.::|.:::.:..:.|.|||..|:.:|..||   |......|.|...: :|| :||.:
  Fly     1 MGCLSGIVNFILYIVNIVFLIVGILLIVLGSIMLSDLS---RFDVAGSGTDPNTIPICVTVLGGL 62

  Fly    64 IVVASIFGSVAVAKDSRVLLICYAVLLVFLLIVQIVLVSISYAASRDFLPDSLRQGLDDLWDLQH 128
            |.|.|.||...:.:.|..:...|..::..|.|:|:||....:.....||.| :...::.||| .|
  Fly    63 IFVVSFFGCYGIFRQSVCMTGAYTSMVFVLFILQLVLTCWVFVNRSAFLGD-MSNLVNLLWD-SH 125

  Fly   129 EGNSTLNTYEEWLHCCGRNSAEDYLHLEKMPPPSCC--LNRDCTKHL-NLFMT--GCEVKFKEYV 188
            : .:.:...||...|||..|..:|.::....|.:||  |:|..|.:. :::.:  ||..||:|: 
  Fly   126 D-YTAMGVLEETFGCCGDTSYTNYNNIGLSVPGTCCGYLDRQATCNTPSVYQSRPGCSAKFEEF- 188

  Fly   189 GAKTANFHSLSWF--------LVIFEFAGSVTTC 214
              ...|...:.|.        ||:|..||::|.|
  Fly   189 --WNDNMDIIRWSGLGLCIFDLVVFLIAGALTNC 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EhNP_523634.1 Tetraspannin 8..220 CDD:278750 62/222 (28%)
tetraspanin_LEL 109..192 CDD:239401 25/87 (29%)
Tsp42EcNP_523629.1 Tetraspannin 7..221 CDD:278750 62/223 (28%)
tetraspanin_LEL 104..193 CDD:239401 25/94 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467692
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D570819at33208
OrthoFinder 1 1.000 - - FOG0001737
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.