DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Eh and Tsp29Fb

DIOPT Version :9

Sequence 1:NP_523634.1 Gene:Tsp42Eh / 35617 FlyBaseID:FBgn0033129 Length:231 Species:Drosophila melanogaster
Sequence 2:NP_001137809.1 Gene:Tsp29Fb / 34212 FlyBaseID:FBgn0032075 Length:308 Species:Drosophila melanogaster


Alignment Length:246 Identity:60/246 - (24%)
Similarity:98/246 - (39%) Gaps:52/246 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MYCTTRLLRYVLCVISGICALGGCLLIWYGAWLLDSLSEEQRMLG-----MDHGEDLAAVLCVLL 60
            |.|.    :|:|.::|.:.||...|||..|..:       |.:.|     :|........|.:.:
  Fly    12 MKCA----KYMLIIVSFMFALTAILLIMVGTTI-------QTIFGDFSLFIDGHFSSPPALLIAI 65

  Fly    61 GTVIVVASIFGSVAVAKDSRVLLICYAV--LLVFLLIVQIVLVS-ISYAASRDFLPDSLRQGLDD 122
            |.:::..:..|:....|:|.:::..|.|  .|||:|.|...:.: :..:..|..|..::.|.|. 
  Fly    66 GFILIAVAALGAYGAVKESVMVINLYGVCLFLVFILEVSAAIAAFVMQSQVRGMLIRTMNQALA- 129

  Fly   123 LWDLQHEG--NSTLNTYEEWLHCCGRNSAE---DYLHL---------EKMPPPSCCLNRDCTKHL 173
              :.:|:.  .|.::..:..|.|||.|..|   |||..         :.:.|.|||.|:..:.:.
  Fly   130 --EYEHDPYVESGVDFMQSMLECCGVNEPEDWKDYLSANVNFTLGVDDVVVPNSCCGNQPTSLND 192

  Fly   174 NLFMT-------GCEVKFKEYV---------GAKTANFHSLSWFLVIFEFA 208
            :..||       ||..|....|         ||.|..|..|...|..|..|
  Fly   193 STQMTCMETYDYGCFRKMNFIVSQSAMLIATGATTVAFVQLLGVLCAFMLA 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EhNP_523634.1 Tetraspannin 8..220 CDD:278750 58/239 (24%)
tetraspanin_LEL 109..192 CDD:239401 28/112 (25%)
Tsp29FbNP_001137809.1 Tetraspannin 14..246 CDD:278750 59/244 (24%)
tetraspanin_LEL 110..218 CDD:239401 26/110 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.