DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Eh and cd82a

DIOPT Version :9

Sequence 1:NP_523634.1 Gene:Tsp42Eh / 35617 FlyBaseID:FBgn0033129 Length:231 Species:Drosophila melanogaster
Sequence 2:NP_997826.2 Gene:cd82a / 324098 ZFINID:ZDB-GENE-030131-2818 Length:256 Species:Danio rerio


Alignment Length:275 Identity:55/275 - (20%)
Similarity:97/275 - (35%) Gaps:83/275 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 CTTRLLRYVLCVISGICALGGCLLIWYGAWLLDSLSEEQRMLGMDHGEDLAAVLCVLL---GTVI 64
            |.| ..:|.|.:.:.|..:.|..::.:|.|:|  |..:..:..:.....:..|:..:|   |:..
Zfish     5 CIT-ATKYFLFLFNFIFFIFGATIMGFGLWIL--LDNQSLIAVLQESSVILKVVSYILIGVGSFS 66

  Fly    65 VVASIFGSVAVAKDSRVLLICYAVLLVFLLIVQIVLVSISYAASRDFL---PDSL---------- 116
            ::....|.:....:.|.||..|...|:.:|:.| |.|||.....||.|   .|.:          
Zfish    67 MLLGFLGCLGAIYEIRCLLGLYFTCLLLILLAQ-VAVSILIYFQRDLLKTEADKIVSQVVANYPG 130

  Fly   117 -RQGLDDLWDLQHEGNSTLNTYEEWLHCCGRNSAEDY--LHLEK-----MPPPSC---------- 163
             .:..:..||.          .:..:.|||.|...|:  .|:.|     :.|.||          
Zfish   131 QNKTAEQAWDY----------LQRTMQCCGWNGRMDWDENHIIKNNTVPLYPCSCHNYSIQAPIV 185

  Fly   164 -----CLNRDCTKHLNLFMTGCEVKFKEYVGAKTANFHSLSWF-------------LVIFEFAGS 210
                 |  :..:....::.|||    .|:||         ||.             :.:.|..|.
Zfish   186 PDNGFC--QASSSDWPIYQTGC----LEHVG---------SWLFTNYGIILGICLGVAVIELLGM 235

  Fly   211 VTTCYLVDSIRNHRD 225
            :.:..|..|:  |::
Zfish   236 ILSMGLCKSV--HQE 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EhNP_523634.1 Tetraspannin 8..220 CDD:278750 51/263 (19%)
tetraspanin_LEL 109..192 CDD:239401 23/118 (19%)
cd82aNP_997826.2 CD37_CD82_like_LEL 106..218 CDD:239413 25/136 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.