DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Eh and Tsp5D

DIOPT Version :9

Sequence 1:NP_523634.1 Gene:Tsp42Eh / 35617 FlyBaseID:FBgn0033129 Length:231 Species:Drosophila melanogaster
Sequence 2:NP_001259266.1 Gene:Tsp5D / 31540 FlyBaseID:FBgn0029837 Length:287 Species:Drosophila melanogaster


Alignment Length:276 Identity:62/276 - (22%)
Similarity:106/276 - (38%) Gaps:67/276 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LRYVLCVISGICALGGCLLIWYGAWLLDSLSEEQRMLGMDHGEDLAAVLCVLLGTVIVVASIFGS 72
            :|...|.::.|..|..|..:..|.||..|.:....:|....|.....:...:.||..|| |.||.
  Fly     9 IRRTFCWLNIILWLCSCAFLGAGLWLRLSYAGYATLLPQHAGLSADTIFMGIGGTGFVV-SFFGC 72

  Fly    73 VAVAKDSRVLLICYAVLLVFLLIVQIVLVSISYAASRDF---LPDSLRQGLDDLWDLQHEGN--- 131
            ......||.||:.|.:|:|.|.:.:.::.||::......   |.:.||.|::..::....|:   
  Fly    73 CGAWVQSRCLLVLYFMLIVMLFMSEFLVGSIAFLFRGGLGRTLANELRFGIERHYNSSDRGSLVA 137

  Fly   132 ----STLNTYEEWLHCCGRNSAEDYLHLEKMP-----PPSCC------------------LNRDC 169
                |..::.::...|||.:|.||:..::..|     |.|||                  :..||
  Fly   138 PSVASIWDSVQQSFECCGVSSYEDWYDIQSWPGRRWVPESCCRTLYDQRQVLTEGSGDGMMRPDC 202

  Fly   170 TKHLNLFM---TGCEVKFKEYVGAKTANFHSL-SWF-------------LVIFEFAGSVTTCYLV 217
            .:..|..:   .||.              ||| |||             :...:..|.:|:..|.
  Fly   203 GRSENPSLWWDKGCA--------------HSLQSWFTGQLNVVGAVGLGIAFVQLFGLITSMLLF 253

  Fly   218 DSIRNHR--DRIRFYN 231
            .::::.|  |..:.|:
  Fly   254 CTVKHKRASDTYKSYS 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EhNP_523634.1 Tetraspannin 8..220 CDD:278750 59/261 (23%)
tetraspanin_LEL 109..192 CDD:239401 22/118 (19%)
Tsp5DNP_001259266.1 Tetraspannin 8..256 CDD:278750 59/261 (23%)
NET-5_like_LEL 105..228 CDD:239418 28/136 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.