DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Eh and Tsp3A

DIOPT Version :9

Sequence 1:NP_523634.1 Gene:Tsp42Eh / 35617 FlyBaseID:FBgn0033129 Length:231 Species:Drosophila melanogaster
Sequence 2:NP_001245504.1 Gene:Tsp3A / 31244 FlyBaseID:FBgn0040334 Length:304 Species:Drosophila melanogaster


Alignment Length:205 Identity:43/205 - (20%)
Similarity:93/205 - (45%) Gaps:31/205 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 TRLLRYVLCVISGICALGGCLLIWYGAWLL-DSLSEEQRMLGMDHGEDL---AAVLCVLLGTVIV 65
            ::.::|::.:::.:..|.|.||:..|.:.. |...:....:.:::..|:   .:::.:|.||||.
  Fly    40 SQCVKYMIFLLNFVFWLFGGLLLGIGVYAFRDKWEDANGSVRLENFYDVFLNISLVMILAGTVIF 104

  Fly    66 VASIFGSVAVAKDSRVLLICYAVLLVFLLIVQIVLVSISYAA--------SRDFLPDSLRQGLDD 122
            :.|..|.|...:::..||..|::.|:...::::.:..:.:..        .:.|....:....||
  Fly   105 LVSFSGCVGALRENTFLLKFYSMCLLLFFLLEMAIAIVCFVCPQYMNTFLEKQFTHKIIHSYRDD 169

  Fly   123 LWDLQHEGNSTLNTYEEWLHCCGRN-------SAEDYLH-----LEKMPPP-SCCLN-RDCTKHL 173
            . |||    :.::..::...|||.:       |..:|.:     :||...| |||:| .|.:..|
  Fly   170 P-DLQ----NFIDFAQQEFKCCGLSNSGYQDWSKNEYFNCSSPSVEKCGVPYSCCINATDISSGL 229

  Fly   174 NLFMTGCEVK 183
            ...|.|..|:
  Fly   230 VNIMCGYGVQ 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EhNP_523634.1 Tetraspannin 8..220 CDD:278750 43/202 (21%)
tetraspanin_LEL 109..192 CDD:239401 23/89 (26%)
Tsp3ANP_001245504.1 Tetraspannin 42..295 CDD:278750 43/203 (21%)
penumbra_like_LEL 144..267 CDD:239411 23/101 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442962
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.