DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Eh and TSPAN16

DIOPT Version :9

Sequence 1:NP_523634.1 Gene:Tsp42Eh / 35617 FlyBaseID:FBgn0033129 Length:231 Species:Drosophila melanogaster
Sequence 2:NP_036598.1 Gene:TSPAN16 / 26526 HGNCID:30725 Length:245 Species:Homo sapiens


Alignment Length:215 Identity:48/215 - (22%)
Similarity:91/215 - (42%) Gaps:36/215 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LRYVLCVISGICALGGCLLIWYGAWLLDSLSEEQRMLGMDHGEDL-AAVLCVLLGTVIVVASIFG 71
            |:.:|.:::|..|:.|.:|:..|.......:....:||:.....| ...||:::|.:.|:....|
Human    11 LKKLLSLLNGFVAVSGIILVGLGIGGKCGGASLTNVLGLSSAYLLHVGNLCLVMGCITVLLGCAG 75

  Fly    72 SVAVAKDSRVLLICYAVLLVFLLIVQIVLVSI---------SYAASRDFLPDSLR---QGLDDLW 124
            .....|:||..|:...:.:|.:||:::...::         ..|....|:  :||   :|.::..
Human    76 WYGATKESRGTLLFCILSMVIVLIMEVTAATVVLLFFPIVGDVALEHTFV--TLRKNYRGYNEPD 138

  Fly   125 DLQHEGNSTLNTYEEWLHCCGRNSAEDY------LHLEKMPPPSCCLN--------RDCTKHLNL 175
            |...:.|..:    |.|.|||.|:..|:      :......|.|||.:        ||.:.:: :
Human   139 DYSTQWNLVM----EKLKCCGVNNYTDFSGSSFEMTTGHTYPRSCCKSIGSVSCDGRDVSPNV-I 198

  Fly   176 FMTGCEVKFKEYVGAKTANF 195
            ...||..|..:.  .||.:|
Human   199 HQKGCFHKLLKI--TKTQSF 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EhNP_523634.1 Tetraspannin 8..220 CDD:278750 48/215 (22%)
tetraspanin_LEL 109..192 CDD:239401 22/99 (22%)
TSPAN16NP_036598.1 Tetraspannin 19..232 CDD:278750 46/207 (22%)
uroplakin_I_like_LEL 120..215 CDD:239409 24/103 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.