DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Eh and tsp-21

DIOPT Version :9

Sequence 1:NP_523634.1 Gene:Tsp42Eh / 35617 FlyBaseID:FBgn0033129 Length:231 Species:Drosophila melanogaster
Sequence 2:NP_001370185.1 Gene:tsp-21 / 259720 WormBaseID:WBGene00023491 Length:301 Species:Caenorhabditis elegans


Alignment Length:265 Identity:57/265 - (21%)
Similarity:100/265 - (37%) Gaps:68/265 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LRYVLCVISGICALGGCLLIWYGAWLLDSLSEEQRMLGMDHGEDLAAVLCVLLGTVIVVASIFGS 72
            |..|..:|||:.:|      ..|.||..|.:....:....:....||.|||..|..|.:....|.
 Worm    19 LANVCFLISGLSSL------IVGVWLYSSKNNFIELTPTSYSALSAAGLCVFTGVTIFIIVAVGY 77

  Fly    73 VAVAKDSRVLLICYAVLLVFLLIVQIVLVSISYAASRDFLPDSLRQG------------------ 119
            :.|:..::.||..|...::.|::|. .:..|:.:..::...::||:.                  
 Worm    78 LGVSWSNKSLLYSYIGFVILLILVH-GIARITGSLHKEEAKENLRKSMLHNINTTAVVTKIGREI 141

  Fly   120 -LDDLWD-LQHEGNSTLNTYEEWLHCCGRNSAEDYLHLEKMP-----PPSCC---------LNRD 168
             |...|| ||.|           |.|||.::..|:.:....|     |.|||         ...:
 Worm   142 KLSLTWDHLQRE-----------LQCCGVDNYTDWHYSVHWPNNLYTPDSCCDPQHFDAENGTEN 195

  Fly   169 CTK----HLNLFMTGCEVKFKEYVGAKTANFHSL---SW---FLVIFEFAGSVTTCYLVDSIRNH 223
            |.|    ...|:..||..||.:::      :|.:   :|   .|.:.|....:.:..::..::|.
 Worm   196 CGKLPDEQSLLYQKGCFPKFSDWL------YHHIILVNWVTSILFVVEILLLILSLVVLRVLKNS 254

  Fly   224 RDRIR 228
            |.:.|
 Worm   255 RHKTR 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EhNP_523634.1 Tetraspannin 8..220 CDD:278750 54/255 (21%)
tetraspanin_LEL 109..192 CDD:239401 25/120 (21%)
tsp-21NP_001370185.1 CD151_like_LEL 106..223 CDD:239408 27/133 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.