DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Eh and Cd53

DIOPT Version :9

Sequence 1:NP_523634.1 Gene:Tsp42Eh / 35617 FlyBaseID:FBgn0033129 Length:231 Species:Drosophila melanogaster
Sequence 2:NP_036655.1 Gene:Cd53 / 24251 RGDID:2310 Length:219 Species:Rattus norvegicus


Alignment Length:219 Identity:57/219 - (26%)
Similarity:98/219 - (44%) Gaps:38/219 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 RLLRYVLCVISGICALGGCLLIWYGAWLLDSLSEEQRMLGMDHGE----DLAAVLCVLLGTVIVV 66
            :||:|||...:.:..:.||.::.:|..||     .|...|:....    .|..|| |::|::|:|
  Rat     7 KLLKYVLFFFNFLFWVCGCCILGFGIHLL-----VQNTYGILFRNLPFLTLGNVL-VIVGSIIMV 65

  Fly    67 ASIFGSVAVAKDSRVLLICYAVLLVFLLIVQIVLVSISYAASRDFLPDSLRQGLDDLWDLQHEGN 131
            .:..|.:...|:::.||:.:.|||:.:|:.::.|..:.:...:. :...:.:||:|.....|..|
  Rat    66 VAFLGCMGSIKENKCLLMSFFVLLLLILLAEVTLAILLFVYEKK-INTLVAEGLNDSIQHYHSDN 129

  Fly   132 STLNTY---EEWLHCCGRNSAEDYLHLEKMPPPSCCLNRDCTKHLNLFMTGCEVKFKEYVGAKTA 193
            ||...:   :..|.|||.|.:.|::   ..||.||....|        :.||..|          
  Rat   130 STRMAWDFIQSQLQCCGVNGSSDWI---SGPPSSCPSGAD--------VQGCYKK---------- 173

  Fly   194 NFHSLSWFLVIFEFAGSVTTCYLV 217
               ..:||...|.:.|.||.|..|
  Rat   174 ---GQAWFHSNFLYIGIVTICVCV 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EhNP_523634.1 Tetraspannin 8..220 CDD:278750 56/217 (26%)
tetraspanin_LEL 109..192 CDD:239401 21/85 (25%)
Cd53NP_036655.1 Tetraspannin 9..210 CDD:278750 56/217 (26%)
CD53_like_LEL 104..186 CDD:239417 24/106 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.