DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Eh and Tspan8

DIOPT Version :9

Sequence 1:NP_523634.1 Gene:Tsp42Eh / 35617 FlyBaseID:FBgn0033129 Length:231 Species:Drosophila melanogaster
Sequence 2:NP_001162150.1 Gene:Tspan8 / 216350 MGIID:2384918 Length:235 Species:Mus musculus


Alignment Length:221 Identity:44/221 - (19%)
Similarity:94/221 - (42%) Gaps:12/221 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LRYVLCVISGICALGGCLLIWYGAWLLDSLSEEQRMLGMDHGED--LAAVLCVLLGTVIVVASIF 70
            |:|.:...:.:..:.|.|::....|:..|...::.:...|...:  :|..:.:.:|::|:|....
Mouse     8 LKYSMFFFNFLFWVCGTLILGLAIWVRVSKDGKEIITSGDSSTNPFIAVNILIAVGSIIMVLGFL 72

  Fly    71 GSVAVAKDSRVLLICYAVLLVFLLIVQIVLVSISYAASRDF---LPDSLRQG---LDDLWDLQHE 129
            |.....|:||.:|:.:.:.|:.:||:|:....:..|...::   |.::|.:.   |.|..|...:
Mouse    73 GCCGAVKESRCMLLLFFIGLLLILILQVAAGILGAAFKPEYNRILNETLYENAKLLSDNTDEAKD 137

  Fly   130 GNSTLNTYEEWLHCCG-RNSAEDYLHLEKMPPPSC-CLNRDCTKH--LNLFMTGCEVKFKEYVGA 190
            ....:..::....||| .|.|.|:.:.......|| |...||..:  .:::...|....|:....
Mouse   138 FQKAMIVFQSEFKCCGLENGAADWGNNFVEAKESCQCTGTDCATYQGSSVYPKTCLSLIKDLFEK 202

  Fly   191 KTANFHSLSWFLVIFEFAGSVTTCYL 216
            .......:::.|.:.|..|.|.:..|
Mouse   203 NIIIVIGIAFGLAVIEILGLVFSMVL 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EhNP_523634.1 Tetraspannin 8..220 CDD:278750 44/221 (20%)
tetraspanin_LEL 109..192 CDD:239401 18/92 (20%)
Tspan8NP_001162150.1 Tetraspannin 8..228 CDD:366035 43/219 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.