DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Eh and tsp-11

DIOPT Version :9

Sequence 1:NP_523634.1 Gene:Tsp42Eh / 35617 FlyBaseID:FBgn0033129 Length:231 Species:Drosophila melanogaster
Sequence 2:NP_509546.4 Gene:tsp-11 / 192064 WormBaseID:WBGene00006637 Length:287 Species:Caenorhabditis elegans


Alignment Length:274 Identity:72/274 - (26%)
Similarity:111/274 - (40%) Gaps:61/274 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 CTTRLLRYVLCVISGICALGGCLLIWYGAWL------LDSLS-EEQRMLGMDHG---EDLA---- 53
            ||.|.|::.|.:.:.:..|.|.:.:..|.||      :|:|: ...::.|.|..   .|||    
 Worm    13 CTARALKFSLFIFNLVFLLCGLICLGIGLWLVLDKYAIDNLAFATAKVQGYDQDAGLRDLATKPT 77

  Fly    54 -----AVLCVLLGTVIVVASIFGSVAVAKDSRVLLICYAVLLVFLLIVQIVLVSISYAAS----- 108
                 ..|..:.|.:::|.:..|....||:.|.||.||:..|:.:|.:||.....::..|     
 Worm    78 AVRQFGYLLFVGGFIVIVVAFLGCCGAAKEWRPLLCCYSSCLMLILAIQIAATIYAFLHSHMFEN 142

  Fly   109 --RDFLPDSLR--QGLDDLWDLQHEGNSTLNTYEEW------LHCCG--------RNSAEDYL-H 154
              ||.|..||:  .|.|:: .:.:.....|.....|      ..|||        .||....| |
 Worm   143 DFRDILHSSLKMYNGTDNM-KVSNNPQDGLLVKTAWDKIMIEKSCCGVDSKIGEFNNSGWYQLNH 206

  Fly   155 LEKMPPPSCC-------LNRDCT---KHLNLFMTGCEVKFKEYVGAKTANFHSLSWFLVIF---E 206
            .....||:||       |...|.   :|.:    ||..|..|.....|::|..:||.:|:|   :
 Worm   207 GRYQFPPACCPPDEHGRLRPYCNTIMRHSH----GCYAKIAESFEEVTSHFKIVSWTVVLFALIQ 267

  Fly   207 FAGSVTTCYLVDSI 220
            ..|.|...:|.|||
 Worm   268 VVGIVVGFWLCDSI 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EhNP_523634.1 Tetraspannin 8..220 CDD:278750 67/267 (25%)
tetraspanin_LEL 109..192 CDD:239401 27/109 (25%)
tsp-11NP_509546.4 Tetraspannin 18..281 CDD:278750 67/267 (25%)
uroplakin_I_like_LEL 132..247 CDD:239409 28/119 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.