DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Eh and tsp-7

DIOPT Version :9

Sequence 1:NP_523634.1 Gene:Tsp42Eh / 35617 FlyBaseID:FBgn0033129 Length:231 Species:Drosophila melanogaster
Sequence 2:NP_492636.1 Gene:tsp-7 / 192062 WormBaseID:WBGene00006633 Length:232 Species:Caenorhabditis elegans


Alignment Length:252 Identity:61/252 - (24%)
Similarity:103/252 - (40%) Gaps:56/252 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LLRYVLCVISGICALGGCLLIWYGAWL-------LDSLSEEQRMLGMDHGEDLAA-VLCVLLGTV 63
            :::|:|.:.:.:..:||..||..|:.|       ||.|.:|:          ||. :|.:::|::
 Worm     8 IVKYLLFLANLVLWVGGLSLIIVGSILQLKFDNVLDILGDER----------LATPILLLVIGSL 62

  Fly    64 IVVASIFGSVAVAKDSRVLLICYAVLLVFLLIVQIVLVSISYAASRDFLPDSLR----------- 117
            ..:....|.....:::..|.:.:||||..|:..:|..|.|.||     |.||.|           
 Worm    63 CTLLGFLGCCGAIRENYCLTVSFAVLLALLITCEIAAVIIGYA-----LHDSFRLGIGNQLQTGM 122

  Fly   118 ------QGLDDLWDLQHEGNSTLNTYEEWLHCCGRNSAEDYLHLEKMPPPSCCLN--RDCTK-HL 173
                  :|::..||..|          :...|||..::.|:|....: |.|||:.  ..|.: :.
 Worm   123 VRYHESRGVESAWDKTH----------QLFECCGVTNSSDWLTFTTI-PDSCCIEEIEGCARENA 176

  Fly   174 NLFMTGCEVKFKEYVGAKTANFHSLSWFLVIFEFAGSVTTCYLVDSIRNHRDRIRFY 230
            .||..||....:::|....|....:...|...:..|....|.|..||.  :|...||
 Worm   177 PLFEPGCIHSVEQWVLKNGAMVGGICAVLAAIQLVGVCFACCLSKSIL--KDFHDFY 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EhNP_523634.1 Tetraspannin 8..220 CDD:278750 56/239 (23%)
tetraspanin_LEL 109..192 CDD:239401 23/102 (23%)
tsp-7NP_492636.1 Tetraspannin 8..223 CDD:278750 56/240 (23%)
NET-5_like_LEL 104..195 CDD:239418 25/106 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.