DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Eh and TSPAN19

DIOPT Version :9

Sequence 1:NP_523634.1 Gene:Tsp42Eh / 35617 FlyBaseID:FBgn0033129 Length:231 Species:Drosophila melanogaster
Sequence 2:NP_001094387.1 Gene:TSPAN19 / 144448 HGNCID:31886 Length:248 Species:Homo sapiens


Alignment Length:252 Identity:61/252 - (24%)
Similarity:108/252 - (42%) Gaps:50/252 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 TRLLRYVLCVISGICALGGCLLIWYGAWLLDSLSEEQRMLGMDHGEDLAAVLCVLL---GTVIVV 66
            |.:::|.|.:|:|...:.|.|.:.:|||||  |.....:...|........:..:|   |:..|:
Human     7 TIIIKYFLNLINGAFLVLGLLFMGFGAWLL--LDRNNFLTAFDENNHFIVPISQILIGMGSSTVL 69

  Fly    67 ASIFGSVAVAKDSRVLLICYAVLLVFLLIVQIVLVS--------------------ISYAASRDF 111
            ..:.|.:.:..:.|.|||.||||:.:...||:||.:                    ||...|:| 
Human    70 FCLLGYIGIHNEIRWLLIVYAVLITWTFAVQVVLSAFIITKKEEVQQLWHDKIDFVISEYGSKD- 133

  Fly   112 LPDSLRQGLDDLWDLQHEGNSTLNTYEEWLHCCGRNSAEDYLHLEK-----MPPPSCCLNR---- 167
            .|:.:.:     |.:       ||..::.|.|||:::..|::..:.     ..|.||..:.    
Human   134 KPEDITK-----WTI-------LNALQKTLQCCGQHNYTDWIKNKNKENSGQVPCSCTKSTLRKW 186

  Fly   168 DCTKHLN-LFMTGCEVKFKEYVGAKTANFHSLSWFLVIFE-FAGSVTTCYLVDSIRN 222
            .|.:.|| .::.|||.|...:..........:::.|:..| |..|:|.|:. .:|:|
Human   187 FCDEPLNATYLEGCENKISAWYNVNVLTLIGINFGLLTSEVFQVSLTVCFF-KNIKN 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EhNP_523634.1 Tetraspannin 8..220 CDD:278750 58/245 (24%)
tetraspanin_LEL 109..192 CDD:239401 20/92 (22%)
TSPAN19NP_001094387.1 Tetraspannin 9..240 CDD:278750 58/246 (24%)
CD37_CD82_like_LEL 107..212 CDD:239413 23/117 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.