DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Eh and Upk1a

DIOPT Version :9

Sequence 1:NP_523634.1 Gene:Tsp42Eh / 35617 FlyBaseID:FBgn0033129 Length:231 Species:Drosophila melanogaster
Sequence 2:NP_081091.1 Gene:Upk1a / 109637 MGIID:98911 Length:257 Species:Mus musculus


Alignment Length:249 Identity:50/249 - (20%)
Similarity:87/249 - (34%) Gaps:78/249 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 VISGICALGGCLLIWYG-------AWLLDSLSEEQRMLGMDHGEDL--AAVLCVLLGTVIVVASI 69
            |:.|:..:|..:::..|       .|:.........::|:...:|:  .|.:.:..|....|.:.
Mouse    14 VVVGLLVVGNIIILLSGLALFAETVWVTADQYRVYPLMGVSGKDDVFAGAWIAIFCGFSFFVVAS 78

  Fly    70 FGSVAVAKDSRVLLICYAVLLVFLLIVQIVLVSISYAASRDFL---PDSLR-------------- 117
            ||..|.....|.:::.|.:|::.:.|.:......|| ..||::   |..:.              
Mouse    79 FGVGAALCRRRYMILTYLLLMLIVYIFECASCITSY-THRDYMVSNPSLITKQMLTYYSADTDQG 142

  Fly   118 QGLDDLWD---LQHEGNSTLNTYEEWLHCCGRNSAEDYLHLEK----------MP-PPSCC---- 164
            |.|..|||   ::.|             |||.:...|:::...          .| ||.||    
Mouse   143 QELTRLWDRIMIEQE-------------CCGTSGPMDWVNYTSAFRAATPEVVFPWPPLCCRRTG 194

  Fly   165 ----LNRDCTKHLNLFMTGCEVKFKEYVGAKTANFH------SLSWFLVIFEFA 208
                :|.|          ||.|...:|:..|....|      |.:|.:..|.||
Mouse   195 NFIPINED----------GCRVGHMDYLFTKGCFEHIGHAIDSYTWGISWFGFA 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EhNP_523634.1 Tetraspannin 8..220 CDD:278750 50/249 (20%)
tetraspanin_LEL 109..192 CDD:239401 24/121 (20%)
Upk1aNP_081091.1 uroplakin_I_like_LEL 111..229 CDD:239409 29/141 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.