DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Eh and Tspan9

DIOPT Version :9

Sequence 1:NP_523634.1 Gene:Tsp42Eh / 35617 FlyBaseID:FBgn0033129 Length:231 Species:Drosophila melanogaster
Sequence 2:NP_001366065.1 Gene:Tspan9 / 109246 MGIID:1924558 Length:330 Species:Mus musculus


Alignment Length:237 Identity:57/237 - (24%)
Similarity:100/237 - (42%) Gaps:52/237 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LRYVLCVISGICALGGCLLIWYGAWL-------------LDSLSEEQRMLGMDHGEDLAAVLCVL 59
            |:|.:.:.:.|..|.||.|:..|.||             ..|||              ||.|.:.
Mouse   100 LKYTMFLFNLIFWLCGCGLLGVGIWLSVSQGNFATFSPSFPSLS--------------AANLVIA 150

  Fly    60 LGTVIVVASIFGSVAVAKDSRVLLICYAVLLVFLLIVQIVLVSISYAASRDFLPDSLRQGL-DDL 123
            :||:::|....|.:...|:::.||:.:.::|:.:|:.:::|: |.:....|.:.::.:|.| :.|
Mouse   151 IGTIVMVTGFLGCLGAIKENKCLLLSFFIVLLIILLAELILI-ILFFVYMDKVNENAKQDLKEGL 214

  Fly   124 WDLQHEGNSTL----NTYEEWLHCCGRNSAEDYLHL--EKMPPPSCCL--NRDCTKHLN--LFMT 178
            .....|.|..|    |..:..:.|||.....|:..:  |...|..||:  ::.|.::..  |:.|
Mouse   215 LLYNTENNVGLKNAWNIIQAEMRCCGVTDYTDWYPVLGENTVPDRCCMENSQGCGRNSTTPLWRT 279

  Fly   179 GCEVKFKEYVGAKTANFHSLSWFLVIFEFAGSVTTCYLVDSI 220
            ||..|.|             .||.......|:|..|.|:..|
Mouse   280 GCYEKVK-------------LWFDDNKHVLGTVGMCILIMQI 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EhNP_523634.1 Tetraspannin 8..220 CDD:278750 56/235 (24%)
tetraspanin_LEL 109..192 CDD:239401 23/93 (25%)
Tspan9NP_001366065.1 Tetraspannin 100..317 CDD:395265 57/237 (24%)
NET-5_like_LEL 196..293 CDD:239418 25/109 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.