DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Eh and TSPAN1

DIOPT Version :9

Sequence 1:NP_523634.1 Gene:Tsp42Eh / 35617 FlyBaseID:FBgn0033129 Length:231 Species:Drosophila melanogaster
Sequence 2:XP_011538762.1 Gene:TSPAN1 / 10103 HGNCID:20657 Length:258 Species:Homo sapiens


Alignment Length:240 Identity:52/240 - (21%)
Similarity:88/240 - (36%) Gaps:51/240 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MYCTTRLLRYVLCVISGICALGGCLLIWYGAWL-LDSLS--------EEQRMLGMDHGEDLAAVL 56
            |.|.: .::.::.:.:.:..|.|..|:..|.|: :|..|        ....|..::.|..|.|. 
Human     1 MQCFS-FIKTMMILFNLLIFLCGAALLAVGIWVSIDGASFLKIFGPLSSSAMQFVNVGYFLIAA- 63

  Fly    57 CVLLGTVIVVASIFGSVAVAKDSRVLLIC--YAVLLVFLLIVQIVLVSISYAA-SRDFLPDSLRQ 118
                |.|:......|......:|:..|:.  :.:||:|:..|...:|::.|.. :..||...:..
Human    64 ----GVVVFALGFLGCYGAKTESKCALVTFFFILLLIFIAEVAAAVVALVYTTMAEHFLTLLVVP 124

  Fly   119 GLDDLWDLQHEGNSTLNTYEEWLHCCGRNSAEDYLHLEKMP--------PPSCC-------LNRD 168
            .:...:..|.:.....||..:.|.|||..:..|:   |..|        ||.||       .|..
Human   125 AIKKDYGSQEDFTQVWNTTMKGLKCCGFTNYTDF---EDSPYFKENSAFPPFCCNDNVTNTANET 186

  Fly   169 CTKHL--NLFMTGCEVKFKEY----------VGAKTANFHSLSWF 201
            |||..  :..:.||   |.:.          ||...|....|.:|
Human   187 CTKQKAHDQKVEGC---FNQLLYDIRTNAVTVGGVAAGIGGLEFF 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EhNP_523634.1 Tetraspannin 8..220 CDD:278750 50/233 (21%)
tetraspanin_LEL 109..192 CDD:239401 25/109 (23%)
TSPAN1XP_011538762.1 Tetraspannin 7..214 CDD:278750 45/217 (21%)
uroplakin_I_like_LEL 110..212 CDD:239409 24/107 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.