DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Eg and tspan11

DIOPT Version :9

Sequence 1:NP_523633.1 Gene:Tsp42Eg / 35616 FlyBaseID:FBgn0033128 Length:218 Species:Drosophila melanogaster
Sequence 2:XP_005164709.1 Gene:tspan11 / 564029 ZFINID:ZDB-GENE-041210-93 Length:260 Species:Danio rerio


Alignment Length:230 Identity:55/230 - (23%)
Similarity:99/230 - (43%) Gaps:47/230 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LFWDIILALFGLVVIGLGV-HIIYKFEH--------FNTAAFVIIAVGVVVVLTALFGALGAARE 68
            |||     :.|.||:|:|: .::.|.|:        |..:|:::|..|.:|::|...|.....||
Zfish    27 LFW-----MGGGVVMGVGIWTLVDKGEYLSLLASSTFAVSAYILILAGGLVMVTGFLGCCAVIRE 86

  Fly    69 SSATSKVFVVILIVLVILEVLAVGFLWVFQTSLLINVDKTFDKLWNDQPVPIKPGNQSQIASLER 133
            ..:....:...|:::.::|::|....:|:..:|...:.:...|...:...  :||.:|...|::|
Zfish    87 QRSCLSTYFSCLLLIFLIELVAGVLAYVYYQALSEELKQHLSKTMMENYA--QPGKESITQSVDR 149

  Fly   134 W---LDCCGNVGPSD-----YILP--------PNSCYN------GESDK----LNLE-GCRQKFL 171
            .   ..|||:....|     ||:.        |:||..      |..|.    ..:| ||..|..
Zfish   150 LQQDFKCCGSNNSLDWMHSVYIMSQAADSRVVPDSCCKTITPQCGRRDHPSNIYKVEGGCITKLE 214

  Fly   172 DFIADRWTTFNLVSLVLLGVELICALLA----YVL 202
            .|:||.......|.:.:..::||.|:|.    |:|
Zfish   215 QFLADHLLIIGAVGIGVACLQLIGAVLTACFIYLL 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EgNP_523633.1 Tetraspannin 17..202 CDD:395265 51/224 (23%)
tetraspanin_LEL 95..176 CDD:239401 24/107 (22%)
tspan11XP_005164709.1 Tetraspannin 16..246 CDD:278750 53/225 (24%)
Vac7 <85..115 CDD:289517 5/29 (17%)
CD151_like_LEL 113..221 CDD:239408 26/109 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1051357at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.