DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Eg and TSPAN11

DIOPT Version :9

Sequence 1:NP_523633.1 Gene:Tsp42Eg / 35616 FlyBaseID:FBgn0033128 Length:218 Species:Drosophila melanogaster
Sequence 2:XP_011518981.1 Gene:TSPAN11 / 441631 HGNCID:30795 Length:302 Species:Homo sapiens


Alignment Length:222 Identity:48/222 - (21%)
Similarity:92/222 - (41%) Gaps:56/222 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 FWDIILALFGLVVIGLGVHIIYK---------FEHFNTAAFVIIAVGVVVVLTALFGALGAARES 69
            ||     :.|..|:.:|:..:.:         ...|..:|:::|..||:|::|...|......|.
Human    27 FW-----VGGAAVLAVGIWTLVEKSGYLSVLASSTFAASAYILIFAGVLVMVTGFLGFGAILWER 86

  Fly    70 SATSKVFVVILIVLVILEVLAVGFLWVF----QTSLLINVDKTFDKLWNDQPVPIKPGNQSQIAS 130
            ......:..:|:|:.::|::|.....|:    ...|..::::|..:.:.      :||.....||
Human    87 KGCLSTYFCLLLVIFLVELVAGVLAHVYYQRLSDELKQHLNRTLAENYG------QPGATQITAS 145

  Fly   131 LERW---LDCCGNVGPSD-----YIL--------PPNSCYN------GE----SDKLNLE-GCRQ 168
            ::|.   ..|||:...:|     |||        .|:||..      |:    |:...:| ||..
Human   146 VDRLQQDFKCCGSNSSADWQHSTYILLREAEGRQVPDSCCKTVVVRCGQRAHPSNIYKVEGGCLT 210

  Fly   169 KFLDFIADRWTTFNLVSLVLLGVELIC 195
            |...|:||     :|:.:..:|:.:.|
Human   211 KLEQFLAD-----HLLLMGAVGIGVAC 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EgNP_523633.1 Tetraspannin 17..202 CDD:395265 46/219 (21%)
tetraspanin_LEL 95..176 CDD:239401 25/111 (23%)
TSPAN11XP_011518981.1 Tetraspannin 16..235 CDD:278750 48/222 (22%)
PHA03242 <50..>118 CDD:177566 14/67 (21%)
CD151_like_LEL 112..220 CDD:239408 27/118 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1051357at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.