DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Eg and Tsp96F

DIOPT Version :9

Sequence 1:NP_523633.1 Gene:Tsp42Eg / 35616 FlyBaseID:FBgn0033128 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_001262976.1 Gene:Tsp96F / 43127 FlyBaseID:FBgn0027865 Length:284 Species:Drosophila melanogaster


Alignment Length:269 Identity:58/269 - (21%)
Similarity:104/269 - (38%) Gaps:85/269 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LFWDIILALFGLVVIGLGVHII----------YKFEHFNTAAFVIIAVGVVVVLTALFGALGAAR 67
            |||     |.||.::...|.::          ..:.|::.|.:|.:|:|:::.|.|.||..|..|
  Fly    20 LFW-----LIGLTIVVTSVWMLTDPTFMLSMTQNYNHYHIALYVFLAIGILITLGAFFGCCGVCR 79

  Fly    68 ESSATSKVFVVILIVLVILEVLAVGFLWVFQTSLLINVDKTFDKLWNDQPVPIKPG-----NQSQ 127
            ||......|..:::::::.::.|..  |.|...         |||.:.....:|..     .||.
  Fly    80 ESQCLLVSFFCVILIVMVAQIAAGA--WAFHNK---------DKLDDIVRAAVKSSVQEEYGQST 133

  Fly   128 IAS-------LERWLDCCGNVGPSD-------------------------YILPPNSCYNGESDK 160
            ::|       |::.|.|||..||.|                         |.:|.:.|.:...|.
  Fly   134 MSSRTVTFDTLQKNLKCCGADGPGDWATSRFNNVDRTNIVEIAVSSMNVFYNIPESCCKDNLKDN 198

  Fly   161 -------------LN----LEGCRQKFLDFIADRWTTFNLVSLVLLGVELICALLAYVLANSIVN 208
                         ||    .:||..|.::.|.:.|.|...|:..::.:||:....|..|..::  
  Fly   199 ECELSRRLKFGGPLNNAIYQQGCVDKLIEIIYENWVTIFAVTAAVILLELLSLTFALSLCCAV-- 261

  Fly   209 RWRRSKYYQ 217
               |:::|:
  Fly   262 ---RNQHYK 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EgNP_523633.1 Tetraspannin 17..202 CDD:395265 52/248 (21%)
tetraspanin_LEL 95..176 CDD:239401 27/134 (20%)
Tsp96FNP_001262976.1 Tetraspannin 9..261 CDD:278750 56/256 (22%)
CD151_like_LEL 107..233 CDD:239408 26/134 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443055
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1051357at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.