DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Eg and cd151l

DIOPT Version :9

Sequence 1:NP_523633.1 Gene:Tsp42Eg / 35616 FlyBaseID:FBgn0033128 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_991213.1 Gene:cd151l / 402948 ZFINID:ZDB-GENE-040426-1868 Length:254 Species:Danio rerio


Alignment Length:247 Identity:54/247 - (21%)
Similarity:103/247 - (41%) Gaps:64/247 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 CSTNVLKGFALFWDIILALFGLVVIGLGV-HIIYKFEH--------FNTAAFVIIAVGVVVVLTA 58
            |.|..||.....::.:..|.|:.|:.:|: .:|.|.::        :..:|:::|..||:|::|.
Zfish    11 CGTICLKYLLFTFNFLFWLAGVAVMAVGIWTVIEKSDYISLLSSKIYAVSAYILIMAGVIVMITG 75

  Fly    59 LFGALGAARESSATSKVFVVILIVLVILEVLAVGFLWVFQTSLLINVDKTFDKLWNDQ------P 117
            :.|.....:|.....:|:.|:|:.:.:||:||....:::...|            ||:      .
Zfish    76 VLGCCATFKEQRRLLRVYFVLLLCIFLLEILAGVLAYIYYQQL------------NDELKENLRE 128

  Fly   118 VPIKPGNQSQ-------IASLERWLDCCGNVGPSDYI-------------LPPNSC-------YN 155
            ..::..|||:       :..|::...|||:...||::             |.|:||       :.
Zfish   129 TMVQKYNQSEQEHVTKAVDKLQQEFKCCGSNSSSDWVDSAWIRSSEADGRLVPDSCCKSPVRKFC 193

  Fly   156 GESDK----LNLE-GCRQKFLDFIADRWTTFNLV-----SLVLLGVELICAL 197
            |..|.    ..:| ||..|..:||.:.......|     |:.::|:...|.|
Zfish   194 GRRDHPSNIYKVEGGCITKLENFILNHLQIIGAVGVGVASVQIVGMFFTCCL 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EgNP_523633.1 Tetraspannin 17..202 CDD:395265 50/233 (21%)
tetraspanin_LEL 95..176 CDD:239401 24/118 (20%)
cd151lNP_991213.1 Tetraspannin 15..249 CDD:278750 52/243 (21%)
CD151_like_LEL 112..221 CDD:239408 24/120 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1051357at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.