DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Eg and Tsp74F

DIOPT Version :9

Sequence 1:NP_523633.1 Gene:Tsp42Eg / 35616 FlyBaseID:FBgn0033128 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_524132.1 Gene:Tsp74F / 39995 FlyBaseID:FBgn0036769 Length:236 Species:Drosophila melanogaster


Alignment Length:254 Identity:49/254 - (19%)
Similarity:88/254 - (34%) Gaps:86/254 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MACSTNVLK------GFALF-----------WDIILALFGLVVIGLGVHIIYKFEHFNTAAFVII 48
            |.|....:|      .|.:|           |.::...|...::|..:        |:.|.:|::
  Fly     7 MDCCGQFVKYSLFIANFVIFVGGAIVFCLTLWTLVDRSFVNELLGTNL--------FSGAVYVLL 63

  Fly    49 AVGVVVVLTALFGALGAARESSATSKVFVVILIVLVILEVLAVGFL-WVFQ-------------T 99
            ...:::.|.:..|.:||.:|.......:.:| :.||.:.:|..|.| :||:             |
  Fly    64 VTSIIICLVSFLGCVGAGKEVKCLLLTYFII-VALVFVTMLIGGVLGYVFRERVQQTMRQEMRST 127

  Fly   100 SLLINVDKTFDKLWNDQPVPIKPGNQSQIASLERWLDCCG--------NVGPSDYILPPNSC--- 153
            ..|....:...:.|:              .:.|| |.|||        ..||     .|.||   
  Fly   128 MALYGSRREITQAWD--------------LTQER-LQCCGVDTWHDWNRYGP-----VPESCCQE 172

  Fly   154 -YNGESDKLNL---------EGCRQKFLDFIADR-----WTTFNLVSLVLLGVELICAL 197
             :.|:..:..:         :||.....:||.|.     .|:..:..|::.|:...|.|
  Fly   173 LFGGQRKECTIFPTITNLYNQGCLYVTTNFIRDHAAVIGGTSIAVAILMIFGMIFSCLL 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EgNP_523633.1 Tetraspannin 17..202 CDD:395265 43/221 (19%)
tetraspanin_LEL 95..176 CDD:239401 21/114 (18%)
Tsp74FNP_524132.1 Tetraspannin 14..231 CDD:395265 46/245 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1051357at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.