DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Eg and cd81

DIOPT Version :9

Sequence 1:NP_523633.1 Gene:Tsp42Eg / 35616 FlyBaseID:FBgn0033128 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_989271.1 Gene:cd81 / 394885 XenbaseID:XB-GENE-946220 Length:237 Species:Xenopus tropicalis


Alignment Length:235 Identity:52/235 - (22%)
Similarity:94/235 - (40%) Gaps:43/235 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 TNVLKGFALFWDIILALFGLVVIGLGV---H-------IIYKFEH------FNTAAFVIIAVGVV 53
            |..:|.....::.|..|.|.|::|:.:   |       :..:||.      |....::|||||.|
 Frog     7 TKCIKYLLFVFNFIFWLAGGVILGVALWLRHDPQTSNLLFQQFEDKHAPGTFYIGVYIIIAVGAV 71

  Fly    54 VVLTALFGALGAARESSATSKVFVVILIVLVILEVLAVGFLWVFQTSLLINVDKT-------FDK 111
            ::.....|..||.:||......|...|::|...|| |.| :|.|     :|.|:.       :.:
 Frog    72 MMFVGFLGCYGAIQESQCLLGTFFACLVILFACEV-AAG-IWGF-----VNRDQVSKEMRLFYSE 129

  Fly   112 LWNDQPVPIKPGNQSQIASLERW---LDCCGNVGPSDYI-------LPPNSCYNGESDKLNLEGC 166
            ::.......|...|..:..|:.:   |.|||:.....|:       .|..|   ...:::.:|.|
 Frog   130 VYQHATTGTKEQQQKALPVLKAFHETLQCCGDASLKKYVTMSITDMCPKRS---NILEQITIEDC 191

  Fly   167 RQKFLDFIADRWTTFNLVSLVLLGVELICALLAYVLANSI 206
            .||.....:.:.....:.::|:..:.:|..:.:.||...|
 Frog   192 HQKIDVLFSTKLYLVGIAAVVVAVIMIIEMIFSMVLCCGI 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EgNP_523633.1 Tetraspannin 17..202 CDD:395265 47/217 (22%)
tetraspanin_LEL 95..176 CDD:239401 18/97 (19%)
cd81NP_989271.1 Tetraspannin 10..227 CDD:366035 48/226 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1051357at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.