DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Eg and TM4SF

DIOPT Version :9

Sequence 1:NP_523633.1 Gene:Tsp42Eg / 35616 FlyBaseID:FBgn0033128 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_001261159.1 Gene:TM4SF / 37786 FlyBaseID:FBgn0020372 Length:292 Species:Drosophila melanogaster


Alignment Length:226 Identity:51/226 - (22%)
Similarity:82/226 - (36%) Gaps:57/226 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 IILALFGLVVIGLGVHIIYKFEHFN--------TAAFVIIAVGVVVVLTALFGALGAARESSATS 73
            ::|||.|...|.||..:::....:.        ..|.:::.:|.|..:....|.....:......
  Fly    19 VLLALTGAAQIFLGTSLLWGHSVYYGIVQNKLWAPAAILLCLGPVTFILCWMGCQATNQRKRCLL 83

  Fly    74 KVFVVILIVLVILEVLAVGFLWVFQ----TSLLINVDKTF----DK----------LWNDQPVPI 120
            .:|..:|:..:.::.:..|:....:    ||:.|.:|.:|    ||          |||..    
  Fly    84 GMFAALLVACICVQFIICGWSLAMRENLPTSVEIFIDDSFVEFLDKFSRTKVDNLHLWNRM---- 144

  Fly   121 KPGNQSQIASLERWLDCCGNVGPSDY---ILP------PNSCYNGESDKLNLEGCRQKFLDFIAD 176
                |||       |.|||..||.||   .||      |...|....|.....||.....:.|.:
  Fly   145 ----QSQ-------LQCCGVDGPLDYRRLSLPWSCCSRPEHAYESACDTHYKRGCLAVVSEQIRN 198

  Fly   177 RW--TTFNLVSLVL---LGVELICALLAYVL 202
            |.  |.|....:.:   ||:  .||:...:|
  Fly   199 RLLITAFGAAIIAIFQSLGI--FCAVHLTIL 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EgNP_523633.1 Tetraspannin 17..202 CDD:395265 50/224 (22%)
tetraspanin_LEL 95..176 CDD:239401 29/107 (27%)
TM4SFNP_001261159.1 Tetraspannin 9..224 CDD:278750 50/221 (23%)
uroplakin_I_like_LEL 111..197 CDD:239409 28/100 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.