DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Eg and Tsp42Ep

DIOPT Version :9

Sequence 1:NP_523633.1 Gene:Tsp42Eg / 35616 FlyBaseID:FBgn0033128 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_001260759.1 Gene:Tsp42Ep / 35626 FlyBaseID:FBgn0033137 Length:250 Species:Drosophila melanogaster


Alignment Length:227 Identity:45/227 - (19%)
Similarity:81/227 - (35%) Gaps:54/227 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 NVLKGFALFWDIILALFGLVVI---GLGVHIIYKFEHFNTAAFVIIAVGVVVVLTALFGALGAAR 67
            |.:|...|..:::..|.|:.|:   |||:.:.......:|.....:.:|..:.:..:||..|...
  Fly     6 NTIKYTGLLSNLLYMLLGIGVMSGAGLGLQMAEPNTPEHTYFVKSLVLGGSICMIVMFGCYGMVA 70

  Fly    68 ESSATSKVFVVILIVLVILEVLAV-----------GFLWVFQTSLLINVDKTFDKLWND---QPV 118
            .....:.:|.:.:::.:..|.|.:           |..|           :..:..|:.   .|.
  Fly    71 NLLCVNLIFTMFILIALAAEYLQLHHYHSPSLRSPGGAW-----------QQLELAWHGLDRDPE 124

  Fly   119 PIKPGNQSQIASLERWLDCCGNVGPSDY----ILPPNSCY----NGESDKLNLEGC------RQK 169
            .:.....||        .|||..|..||    :|.|.|||    |..:.::...||      .|:
  Fly   125 LMHQYEASQ--------HCCGYNGADDYKRLHLLVPASCYQAAVNDTAQQIYPSGCLETLNRSQR 181

  Fly   170 FLDFIADR---WTTFNLVSLVLLGVELICALL 198
            ::.. .|:   |....|...:||....:..||
  Fly   182 YIQH-RDKLYMWAIVGLEIFILLQTVALSVLL 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EgNP_523633.1 Tetraspannin 17..202 CDD:395265 42/216 (19%)
tetraspanin_LEL 95..176 CDD:239401 20/97 (21%)
Tsp42EpNP_001260759.1 Tetraspannin <51..213 CDD:278750 35/182 (19%)
tetraspanin_LEL 91..183 CDD:239401 22/110 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443033
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001737
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.