DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Eg and Tsp42Ek

DIOPT Version :9

Sequence 1:NP_523633.1 Gene:Tsp42Eg / 35616 FlyBaseID:FBgn0033128 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_001246161.1 Gene:Tsp42Ek / 35621 FlyBaseID:FBgn0033133 Length:215 Species:Drosophila melanogaster


Alignment Length:232 Identity:51/232 - (21%)
Similarity:105/232 - (45%) Gaps:40/232 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MACSTNVLKGFALFWDIILALFGLVVIGLGVHIIYKFEHFNTAAFVIIAVGV--VVVLTALFGAL 63
            |.|::..:|.|....:.:.||.||.:|.:....:.|    ...|:::...|:  ::.::|:.|..
  Fly     1 MGCTSGCVKCFLNTLNTLNALSGLSLIAIATLALSK----APIAYILFLYGLGGIIFVSAVLGCC 61

  Fly    64 GAARESSATSKVFVVILIVLVILEVLAVGFLWVFQTSLLINVDKTFDKL--------WNDQPVPI 120
            |...|:...:..:..:|:..:|:.:|.: |.:.|       .::..:|.        |:::.|  
  Fly    62 GICMENVCMTATYGFLLLAQLIISLLGI-FRFKF-------TEEYIEKFAAEEVQMKWDEELV-- 116

  Fly   121 KPGNQSQIASLERWLDCCGNVGPSDYI------LPPNSCYNGESDKL--NLEGCRQKFLDFIADR 177
            :||......::   .:|||...|.||:      ||| |||..|..::  .|.||.||..:.....
  Fly   117 EPGAMDIYQTV---YECCGRDSPDDYVAIGRQTLPP-SCYPQEDPQMPHYLAGCVQKSSENFVVL 177

  Fly   178 WTTFNLVSLVLLGVELICALLAYVLANSIVNRWRRSK 214
            ::..:..:.:.||:.::..:.|:.|    |.|:|:.:
  Fly   178 FSYAHDTNWIALGITILMMIAAFYL----VGRFRKQR 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EgNP_523633.1 Tetraspannin 17..202 CDD:395265 43/202 (21%)
tetraspanin_LEL 95..176 CDD:239401 24/96 (25%)
Tsp42EkNP_001246161.1 Tetraspannin 7..202 CDD:278750 45/212 (21%)
tetraspanin_LEL 94..174 CDD:239401 24/92 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001737
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.