DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Eg and Tsp42Ej

DIOPT Version :9

Sequence 1:NP_523633.1 Gene:Tsp42Eg / 35616 FlyBaseID:FBgn0033128 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_523636.1 Gene:Tsp42Ej / 35620 FlyBaseID:FBgn0033132 Length:227 Species:Drosophila melanogaster


Alignment Length:207 Identity:41/207 - (19%)
Similarity:82/207 - (39%) Gaps:55/207 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 ALFGLVVIGL--GVHIIYKFEHFNTAAFVIIAVGVVVVLTALFGALGAARESSATSKVFVVILIV 82
            |:||:..:|:  .:.:.||:     :.:.:|..|:|:      .|||:                 
  Fly    54 AVFGVAFLGMYVALKVSYKY-----SIYYLICSGLVI------AALGS----------------- 90

  Fly    83 LVILEVLAVGFLWVFQTSLLINVDKTFDKLWNDQPVPIKPGNQSQIASLERWLDCCGNVGPSDYI 147
                      :|:.| |::...:...|::...|. ...|..:..::..:.....|||..||.||:
  Fly    91 ----------YLFTF-TAMREQLMGRFEERMRDL-FERKTHSDDKMQPVHSLFGCCGIEGPQDYL 143

  Fly   148 ------LPPNSCYNGESDK---LNLEGCRQKFLDFIADRWTTFNLVS-LVLLGVELICALLAYVL 202
                  ||.:.||..:..|   :..|||..|.:..:..: ...|..| :.::.:|.:....||.|
  Fly   144 QEEHGALPSSCCYAFDCSKPAHVYEEGCSTKAVATLRMQ-AELNYYSCMAIIALEFLGLFTAYHL 207

  Fly   203 ANSIVNRWRRSK 214
            ..:  .::.::|
  Fly   208 GKA--RKYAKTK 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EgNP_523633.1 Tetraspannin 17..202 CDD:395265 39/193 (20%)
tetraspanin_LEL 95..176 CDD:239401 21/89 (24%)
Tsp42EjNP_523636.1 Tetraspannin 11..211 CDD:278750 40/199 (20%)
tetraspanin_LEL 97..183 CDD:239401 19/87 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.