DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Eg and Tsp42Ef

DIOPT Version :9

Sequence 1:NP_523633.1 Gene:Tsp42Eg / 35616 FlyBaseID:FBgn0033128 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_523632.2 Gene:Tsp42Ef / 35615 FlyBaseID:FBgn0033127 Length:220 Species:Drosophila melanogaster


Alignment Length:224 Identity:64/224 - (28%)
Similarity:109/224 - (48%) Gaps:18/224 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 STNVLKGFALFWDIILALFGLVVIGLGVHIIYKF---EHFNTAAFVIIAVGVVVVLTALFGALGA 65
            ||:.:|......|::..|..||:|..|:::...:   |.....|:..:.:|...:|..|:|.|.|
  Fly     3 STSSVKLIVYALDVLCTLLALVLISFGIYVAVSYNLNEIGQLTAYGYVGLGAAALLVVLWGYLSA 67

  Fly    66 ARESSATSKVFVVILIVLVILEVLAVGFLWVFQTSLLINVDKTFDKLWNDQPVPIKPGNQSQIAS 130
            .||:...:..|::.|.:::|.:...|..|...:.::..|:....:..|.::  ...||..|   .
  Fly    68 WRENVCCTVTFIIFLCLVIIAQFAVVYLLITQEKTVASNLANALEATWEEE--LNSPGAMS---L 127

  Fly   131 LERWLDCCGNVGPSDYI----LPPNSCYNGESDKLNLE-----GCRQKFLDFIADRWTTFNLVSL 186
            .:.|..|||...|.|||    |||.:|:... ||...|     |||.:|.::.......||:::|
  Fly   128 YQNWFQCCGRGSPQDYIVNERLPPETCFRNH-DKSKPENLIHTGCRVEFENYWQHLTKIFNILAL 191

  Fly   187 VLLGVELICALLAYVLANSIVNRWRRSKY 215
            ||:|.||:.::::..|.|||.|..|||.:
  Fly   192 VLIGFELLLSVISCRLCNSIRNDARRSYF 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EgNP_523633.1 Tetraspannin 17..202 CDD:395265 52/196 (27%)
tetraspanin_LEL 95..176 CDD:239401 24/89 (27%)
Tsp42EfNP_523632.2 Tetraspannin 7..211 CDD:278750 56/209 (27%)
tetraspanin_LEL 103..181 CDD:239401 24/83 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449968
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001737
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.