DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Eg and Tsp39D

DIOPT Version :9

Sequence 1:NP_523633.1 Gene:Tsp42Eg / 35616 FlyBaseID:FBgn0033128 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_523612.3 Gene:Tsp39D / 35405 FlyBaseID:FBgn0032943 Length:235 Species:Drosophila melanogaster


Alignment Length:237 Identity:60/237 - (25%)
Similarity:102/237 - (43%) Gaps:45/237 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LKGFALFWDIILALFGLVVIGLGVHIIYKFEHFN--------TAAFVIIAVGVVVVLTALFGALG 64
            :|....|.:::.||.||::..:|..:...:.|::        ||..:::.||..|.:....|..|
  Fly     9 VKYLTFFCNLLFALTGLLIFLVGGMVQLNYAHYSNFVSDHVWTAPIILMIVGAAVAVICFLGCCG 73

  Fly    65 AARESSATSKVFVVILIVLVILEVLAVGFL-WVFQTSLLINVDKTFDKLWNDQPVPIKPGNQSQI 128
            |.:|||.....|.::.:|:.:.|: .:|.. :|..|.|...::..|:...  |....:...:...
  Fly    74 ALKESSCMILSFALLAVVIFLFEI-GLGLAGYVKHTGLHQIMESQFNSTM--QHYKERADYRDAW 135

  Fly   129 ASLERWLDCCGNVGPSDY-------ILPPNSCYNGESDKLNL-------------EGCRQKFLDF 173
            ..|:..|||||..||:|:       .||...|     ..:||             .||.||.|:.
  Fly   136 TLLQTELDCCGINGPNDWETVYRNSTLPAACC-----SVINLSEAKECTNTHATQHGCLQKLLEI 195

  Fly   174 IADRWTTFNLVSLVL--LGVELICALLAYVLANSIVNRWRRS 213
            :..:  |..|.|:||  .|::::..|.|..|..|    :|||
  Fly   196 LDSK--TLILASVVLGVAGIQMLTILFACCLYRS----FRRS 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EgNP_523633.1 Tetraspannin 17..202 CDD:395265 53/215 (25%)
tetraspanin_LEL 95..176 CDD:239401 24/100 (24%)
Tsp39DNP_523612.3 Tetraspannin 8..227 CDD:278750 56/227 (25%)
tetraspanin_LEL 104..200 CDD:239401 24/104 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.