DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Eg and Tsp33B

DIOPT Version :10

Sequence 1:NP_523633.1 Gene:Tsp42Eg / 35616 FlyBaseID:FBgn0033128 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_523552.1 Gene:Tsp33B / 34590 FlyBaseID:FBgn0032376 Length:326 Species:Drosophila melanogaster


Alignment Length:52 Identity:13/52 - (25%)
Similarity:20/52 - (38%) Gaps:3/52 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   175 ILIDDTVDMSVSASAASGKRRARSISGVTRQGVP--IIDEPYVP-RRNRTRH 223
            ::|..||....:..|...:........:.||.:|  ....|.:| .|.|.||
  Fly    12 LVILATVSFLHAMEANEAEAAEMEFGDMLRQKIPKNFTKLPPIPEERGRGRH 63

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
Tsp42EgNP_523633.1 Tetraspanin 17..204 CDD:459767 4/28 (14%)