DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Eg and Tsp29Fb

DIOPT Version :9

Sequence 1:NP_523633.1 Gene:Tsp42Eg / 35616 FlyBaseID:FBgn0033128 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_001137809.1 Gene:Tsp29Fb / 34212 FlyBaseID:FBgn0032075 Length:308 Species:Drosophila melanogaster


Alignment Length:259 Identity:62/259 - (23%)
Similarity:115/259 - (44%) Gaps:65/259 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MACSTNVLKGFALFWDIILALFGLVVIGLGVHI--------IYKFEHFNTAAFVIIAVGVVVVLT 57
            |.|:..:|    :....:.||..:::|.:|..|        ::...||::...::||:|.:::..
  Fly    12 MKCAKYML----IIVSFMFALTAILLIMVGTTIQTIFGDFSLFIDGHFSSPPALLIAIGFILIAV 72

  Fly    58 ALFGALGAARESSATSKVFVVILIVLVILEVLAVGFLWVFQTS----LLINVDKTFDKLWNDQPV 118
            |..||.||.:||.....::.|.|.::.||||.|....:|.|:.    |:..:::...:..:|   
  Fly    73 AALGAYGAVKESVMVINLYGVCLFLVFILEVSAAIAAFVMQSQVRGMLIRTMNQALAEYEHD--- 134

  Fly   119 PIKPGNQSQIASLERWLDCCGNVGPSDY----------------ILPPNSCYNGESDKLN----- 162
               |..:|.:..::..|:|||...|.|:                ::.||||...:...||     
  Fly   135 ---PYVESGVDFMQSMLECCGVNEPEDWKDYLSANVNFTLGVDDVVVPNSCCGNQPTSLNDSTQM 196

  Fly   163 --LE----GCRQKFLDFIADRWTTFNLVSLVLLG------VELICALLAYVLANSIVNRWRRSK 214
              :|    ||.:| ::||..:     ...|:..|      |:|:..|.|::||.::    ||:|
  Fly   197 TCMETYDYGCFRK-MNFIVSQ-----SAMLIATGATTVAFVQLLGVLCAFMLAKTL----RRNK 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EgNP_523633.1 Tetraspannin 17..202 CDD:395265 54/229 (24%)
tetraspanin_LEL 95..176 CDD:239401 24/111 (22%)
Tsp29FbNP_001137809.1 Tetraspannin 14..246 CDD:278750 58/247 (23%)
tetraspanin_LEL 110..218 CDD:239401 24/119 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.