DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Eg and cd63

DIOPT Version :9

Sequence 1:NP_523633.1 Gene:Tsp42Eg / 35616 FlyBaseID:FBgn0033128 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_955837.1 Gene:cd63 / 321461 ZFINID:ZDB-GENE-030131-180 Length:237 Species:Danio rerio


Alignment Length:239 Identity:62/239 - (25%)
Similarity:112/239 - (46%) Gaps:45/239 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LKGFALFWDIILALFGLVVIGLGVHIIYKFEHFNTA--------AFVIIAVGVVVVLTALFGALG 64
            :|....|::.|..|.||.:|.||: :::...| |||        ..|:|.|||::...:.||..|
Zfish    10 VKYLLFFFNFIFWLCGLALIVLGI-LVHVSLH-NTAILQGASGSPMVLIVVGVIIFFISFFGCCG 72

  Fly    65 AARESSATSKVFVVILIVLVILEVLAVGFLWVFQTSLLINVDKTFDKLWNDQPVPIKPGNQSQ-- 127
            |.:|:......|.:||.::||.|:.|....::|:..:...:|::|:.:       |...|:::  
Zfish    73 AWKENQCMVVTFAIILSLIVITEIGAGIAGYIFRGKVNELLDQSFNTM-------IAGYNKTEEY 130

  Fly   128 ---IASLERWLDCCGNVGPSDYI--------LPPNSCYN-------GESDK---LNLEGCRQKFL 171
               :.|:::.|.|||....||::        :|.:.|.|       |...|   :.||||:....
Zfish   131 RTTLDSIQKQLKCCGGNSSSDWVNFSADHISVPDSCCKNVTKNCGIGAMTKPTVIYLEGCQPILE 195

  Fly   172 DFIADRWTTFNLVSLVLLGVELICALLAYVLANSIVNRWRRSKY 215
            ..|.:......:.:||:..|::...:||.:|:.:|     ||.|
Zfish   196 TRIKENILWIAVGALVIGFVQITGIVLACILSRAI-----RSGY 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EgNP_523633.1 Tetraspannin 17..202 CDD:395265 55/215 (26%)
tetraspanin_LEL 95..176 CDD:239401 22/103 (21%)
cd63NP_955837.1 Tetraspannin 9..230 CDD:278750 58/228 (25%)
CD63_LEL 103..202 CDD:239419 22/105 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.