DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp42Eg and Tsp5D

DIOPT Version :9

Sequence 1:NP_523633.1 Gene:Tsp42Eg / 35616 FlyBaseID:FBgn0033128 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_001259266.1 Gene:Tsp5D / 31540 FlyBaseID:FBgn0029837 Length:287 Species:Drosophila melanogaster


Alignment Length:259 Identity:49/259 - (18%)
Similarity:97/259 - (37%) Gaps:63/259 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 W-DIILALFGLVVIGLGVHIIYKFEHFNT---------AAFVIIAVGVVVVLTALFGALGAARES 69
            | :|||.|.....:|.|:.:...:..:.|         |..:.:.:|....:.:.||..||..:|
  Fly    15 WLNIILWLCSCAFLGAGLWLRLSYAGYATLLPQHAGLSADTIFMGIGGTGFVVSFFGCCGAWVQS 79

  Fly    70 SATSKVFVVILIVLVILEVLAVGFLWVFQ--------TSLLINVDKTFDKLWNDQPVPIKPGNQS 126
            .....::.:::::|.:.|.|.....::|:        ..|...:::.::.  :|:...:.|...|
  Fly    80 RCLLVLYFMLIVMLFMSEFLVGSIAFLFRGGLGRTLANELRFGIERHYNS--SDRGSLVAPSVAS 142

  Fly   127 QIASLERWLDCCGNVGPSDYI----------LPPNSC---YN------------------GESDK 160
            ...|:::..:|||.....|:.          :|.:.|   |:                  |.|:.
  Fly   143 IWDSVQQSFECCGVSSYEDWYDIQSWPGRRWVPESCCRTLYDQRQVLTEGSGDGMMRPDCGRSEN 207

  Fly   161 LNL---EGCRQKFLDFIADRWTT--FNLVSLVLLGVELI--CALLAYVLANSIVNRWRRSKYYQ 217
            .:|   :||....     ..|.|  .|:|..|.||:..:  ..|:..:|....|...|.|..|:
  Fly   208 PSLWWDKGCAHSL-----QSWFTGQLNVVGAVGLGIAFVQLFGLITSMLLFCTVKHKRASDTYK 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp42EgNP_523633.1 Tetraspannin 17..202 CDD:395265 43/239 (18%)
tetraspanin_LEL 95..176 CDD:239401 18/122 (15%)
Tsp5DNP_001259266.1 Tetraspannin 8..256 CDD:278750 45/247 (18%)
NET-5_like_LEL 105..228 CDD:239418 20/129 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.